KEGG   Lagenorhynchus albirostris (white-beaked dolphin): 132514489
Entry
132514489         CDS       T10760                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
lalb  Lagenorhynchus albirostris (white-beaked dolphin)
Pathway
lalb01521  EGFR tyrosine kinase inhibitor resistance
lalb01522  Endocrine resistance
lalb04010  MAPK signaling pathway
lalb04012  ErbB signaling pathway
lalb04014  Ras signaling pathway
lalb04015  Rap1 signaling pathway
lalb04062  Chemokine signaling pathway
lalb04068  FoxO signaling pathway
lalb04071  Sphingolipid signaling pathway
lalb04072  Phospholipase D signaling pathway
lalb04137  Mitophagy - animal
lalb04140  Autophagy - animal
lalb04150  mTOR signaling pathway
lalb04151  PI3K-Akt signaling pathway
lalb04210  Apoptosis
lalb04211  Longevity regulating pathway
lalb04213  Longevity regulating pathway - multiple species
lalb04218  Cellular senescence
lalb04360  Axon guidance
lalb04370  VEGF signaling pathway
lalb04371  Apelin signaling pathway
lalb04540  Gap junction
lalb04550  Signaling pathways regulating pluripotency of stem cells
lalb04625  C-type lectin receptor signaling pathway
lalb04650  Natural killer cell mediated cytotoxicity
lalb04660  T cell receptor signaling pathway
lalb04662  B cell receptor signaling pathway
lalb04664  Fc epsilon RI signaling pathway
lalb04714  Thermogenesis
lalb04720  Long-term potentiation
lalb04722  Neurotrophin signaling pathway
lalb04725  Cholinergic synapse
lalb04726  Serotonergic synapse
lalb04730  Long-term depression
lalb04810  Regulation of actin cytoskeleton
lalb04910  Insulin signaling pathway
lalb04912  GnRH signaling pathway
lalb04915  Estrogen signaling pathway
lalb04916  Melanogenesis
lalb04917  Prolactin signaling pathway
lalb04919  Thyroid hormone signaling pathway
lalb04921  Oxytocin signaling pathway
lalb04926  Relaxin signaling pathway
lalb04929  GnRH secretion
lalb04933  AGE-RAGE signaling pathway in diabetic complications
lalb04935  Growth hormone synthesis, secretion and action
lalb05010  Alzheimer disease
lalb05022  Pathways of neurodegeneration - multiple diseases
lalb05034  Alcoholism
lalb05160  Hepatitis C
lalb05161  Hepatitis B
lalb05163  Human cytomegalovirus infection
lalb05165  Human papillomavirus infection
lalb05166  Human T-cell leukemia virus 1 infection
lalb05167  Kaposi sarcoma-associated herpesvirus infection
lalb05170  Human immunodeficiency virus 1 infection
lalb05200  Pathways in cancer
lalb05203  Viral carcinogenesis
lalb05205  Proteoglycans in cancer
lalb05206  MicroRNAs in cancer
lalb05207  Chemical carcinogenesis - receptor activation
lalb05208  Chemical carcinogenesis - reactive oxygen species
lalb05210  Colorectal cancer
lalb05211  Renal cell carcinoma
lalb05213  Endometrial cancer
lalb05214  Glioma
lalb05215  Prostate cancer
lalb05216  Thyroid cancer
lalb05218  Melanoma
lalb05219  Bladder cancer
lalb05220  Chronic myeloid leukemia
lalb05221  Acute myeloid leukemia
lalb05223  Non-small cell lung cancer
lalb05224  Breast cancer
lalb05225  Hepatocellular carcinoma
lalb05226  Gastric cancer
lalb05230  Central carbon metabolism in cancer
lalb05231  Choline metabolism in cancer
lalb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lalb05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lalb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    132514489 (NRAS)
   04012 ErbB signaling pathway
    132514489 (NRAS)
   04014 Ras signaling pathway
    132514489 (NRAS)
   04015 Rap1 signaling pathway
    132514489 (NRAS)
   04370 VEGF signaling pathway
    132514489 (NRAS)
   04371 Apelin signaling pathway
    132514489 (NRAS)
   04068 FoxO signaling pathway
    132514489 (NRAS)
   04072 Phospholipase D signaling pathway
    132514489 (NRAS)
   04071 Sphingolipid signaling pathway
    132514489 (NRAS)
   04151 PI3K-Akt signaling pathway
    132514489 (NRAS)
   04150 mTOR signaling pathway
    132514489 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    132514489 (NRAS)
   04137 Mitophagy - animal
    132514489 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    132514489 (NRAS)
   04218 Cellular senescence
    132514489 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    132514489 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    132514489 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    132514489 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    132514489 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    132514489 (NRAS)
   04660 T cell receptor signaling pathway
    132514489 (NRAS)
   04662 B cell receptor signaling pathway
    132514489 (NRAS)
   04664 Fc epsilon RI signaling pathway
    132514489 (NRAS)
   04062 Chemokine signaling pathway
    132514489 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    132514489 (NRAS)
   04929 GnRH secretion
    132514489 (NRAS)
   04912 GnRH signaling pathway
    132514489 (NRAS)
   04915 Estrogen signaling pathway
    132514489 (NRAS)
   04917 Prolactin signaling pathway
    132514489 (NRAS)
   04921 Oxytocin signaling pathway
    132514489 (NRAS)
   04926 Relaxin signaling pathway
    132514489 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    132514489 (NRAS)
   04919 Thyroid hormone signaling pathway
    132514489 (NRAS)
   04916 Melanogenesis
    132514489 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    132514489 (NRAS)
   04726 Serotonergic synapse
    132514489 (NRAS)
   04720 Long-term potentiation
    132514489 (NRAS)
   04730 Long-term depression
    132514489 (NRAS)
   04722 Neurotrophin signaling pathway
    132514489 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    132514489 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    132514489 (NRAS)
   04213 Longevity regulating pathway - multiple species
    132514489 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    132514489 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    132514489 (NRAS)
   05206 MicroRNAs in cancer
    132514489 (NRAS)
   05205 Proteoglycans in cancer
    132514489 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    132514489 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    132514489 (NRAS)
   05203 Viral carcinogenesis
    132514489 (NRAS)
   05230 Central carbon metabolism in cancer
    132514489 (NRAS)
   05231 Choline metabolism in cancer
    132514489 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    132514489 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    132514489 (NRAS)
   05225 Hepatocellular carcinoma
    132514489 (NRAS)
   05226 Gastric cancer
    132514489 (NRAS)
   05214 Glioma
    132514489 (NRAS)
   05216 Thyroid cancer
    132514489 (NRAS)
   05221 Acute myeloid leukemia
    132514489 (NRAS)
   05220 Chronic myeloid leukemia
    132514489 (NRAS)
   05218 Melanoma
    132514489 (NRAS)
   05211 Renal cell carcinoma
    132514489 (NRAS)
   05219 Bladder cancer
    132514489 (NRAS)
   05215 Prostate cancer
    132514489 (NRAS)
   05213 Endometrial cancer
    132514489 (NRAS)
   05224 Breast cancer
    132514489 (NRAS)
   05223 Non-small cell lung cancer
    132514489 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    132514489 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    132514489 (NRAS)
   05161 Hepatitis B
    132514489 (NRAS)
   05160 Hepatitis C
    132514489 (NRAS)
   05163 Human cytomegalovirus infection
    132514489 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    132514489 (NRAS)
   05165 Human papillomavirus infection
    132514489 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    132514489 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    132514489 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    132514489 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    132514489 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    132514489 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    132514489 (NRAS)
   01522 Endocrine resistance
    132514489 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lalb04131]
    132514489 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lalb04147]
    132514489 (NRAS)
   04031 GTP-binding proteins [BR:lalb04031]
    132514489 (NRAS)
Membrane trafficking [BR:lalb04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    132514489 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    132514489 (NRAS)
Exosome [BR:lalb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   132514489 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   132514489 (NRAS)
  Exosomal proteins of breast cancer cells
   132514489 (NRAS)
  Exosomal proteins of colorectal cancer cells
   132514489 (NRAS)
GTP-binding proteins [BR:lalb04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    132514489 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 132514489
NCBI-ProteinID: XP_059995251
LinkDB
Position
2:85532269..85542577
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctgatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aagcgtgtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt
tgtatgggattgccatgtgtagtgatgtaa

DBGET integrated database retrieval system