Lysobacter antibioticus ATCC 29479: GLA29479_4080 Help Entry GLA29479_4080     CDS       T04526                                  Symbol acpC Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism laq  Lysobacter antibioticus ATCC 29479 Pathway laq01100   Metabolic pathways laq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:laq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GLA29479_4080 (acpC)    00074 Mycolic acid biosynthesis     GLA29479_4080 (acpC)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GLA29479_4080 (acpC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PIN Motif Other DBs NCBI-ProteinID:  ALN64926 UniProt:  A0A0S2E2H3 LinkDB All DBs Position complement(4444824..4445093) Genome browser AA seq 89 aa AA seqDB search MSEQSPAERELAQLLVESLNLEDVAPEQIDPEAALFNEGLGLDSIDALELALAITKRYGF QLRSDSDENRRIFASLRALSAHIEQQRAG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgaacaaagccccgccgaacgcgaactggcgcagctgctggtcgagagcctgaac ctggaagacgtggcaccggagcagatcgatccggaagcggcgctgttcaacgaaggcctc ggcctggactcgatcgacgcactggaactcgccctggcgatcaccaagcgctacggcttc cagctgcgctccgacagcgacgagaaccgccgcatcttcgcctcgctgcgcgcgctgtcg gcgcatatcgagcagcagcgggccggctga

DBGET integrated database retrieval system