KEGG   Lysobacter antibioticus ATCC 29479: GLA29479_549
Entry
GLA29479_549      CDS       T04526                                 
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase, iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
laq  Lysobacter antibioticus ATCC 29479
Pathway
laq00190  Oxidative phosphorylation
laq01100  Metabolic pathways
laq02020  Two-component system
laq04148  Efferocytosis
Module
laq_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:laq00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GLA29479_549 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GLA29479_549 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    GLA29479_549 (petA)
Enzymes [BR:laq01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     GLA29479_549 (petA)
SSDB
Motif
Pfam: UCR_Fe-S_N Rieske
Other DBs
NCBI-ProteinID: ALN61434
LinkDB
Position
complement(571931..572482)
AA seq 183 aa
MVGAVGAGFAAVPFIKSWNPSARAKLAGAPVTADISALTEGQRLVMEWRGQPIWIVKRSK
AILDILPTLDGRLRDPKSENVDQQPAYVREKSPELRSLKPEISVLVGLCTHLGCSPEMKA
EIRPEAFDPEWKGGYFCPCHKSRFDMAGRVFEGVPAPTNLLVPPHYYENDNTIVIGVDPK
GAA
NT seq 552 nt   +upstreamnt  +downstreamnt
gtggtcggtgccgtgggcgccggctttgccgcggtgcctttcatcaagtcctggaacccc
agcgcgcgcgccaagctcgccggcgctccggtgactgccgatatcagcgccctcaccgaa
ggccagcgcctggtcatggaatggcgcggtcagccgatctggatcgtcaagcgttccaag
gccattctcgacatcctgccgaccctcgacgggcgcctgcgcgaccccaagtccgagaac
gtcgaccagcagccggcctacgtgcgcgagaagagcccggaactgcgctcgctcaagccc
gagatctcggtgctggtgggcctgtgcacccacctgggctgctcgccggaaatgaaggcc
gagatccggcccgaggcgttcgacccggagtggaagggcggctatttctgcccctgccac
aagtcgcgtttcgacatggccggtcgcgtgttcgagggcgtaccggccccgaccaacctg
ctggtgcctccgcactactacgaaaacgacaacaccatcgtcatcggtgttgatccgaag
ggagcggcgtaa

DBGET integrated database retrieval system