Leisingera aquaemixtae: R2C4_01820 Help Entry R2C4_01820        CDS       T06085                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism laqu  Leisingera aquaemixtae Pathway laqu01100   Metabolic pathways laqu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:laqu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     R2C4_01820    00074 Mycolic acid biosynthesis     R2C4_01820   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     R2C4_01820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QDI74562 LinkDB All DBs Position unnamed4:complement(56814..57065) Genome browser AA seq 83 aa AA seqDB search MTQTDMRAVFLEELTRVAPDIDPAGVSDGDHLQDDLELDSMDILNLVAALHQRLGIEIPE ADYPRIATAGAAAAYLSAAAAAD NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacccagaccgatatgcgtgccgttttccttgaagagctgacccgggtggccccggac attgaccccgcaggggtgtcggacggggatcatctgcaggatgatctggagctggattcg atggatattttgaatctggtggctgccctgcaccagcggcttggcatcgaaatcccggag gcggattacccgcggattgccaccgcgggggccgccgccgcttacctgtctgccgcggcg gctgcggattag

DBGET integrated database retrieval system