Leisingera aquaemixtae: R2C4_09520 Help Entry R2C4_09520        CDS       T06085                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism laqu  Leisingera aquaemixtae Pathway laqu01100   Metabolic pathways laqu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:laqu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     R2C4_09520    00074 Mycolic acid biosynthesis     R2C4_09520   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     R2C4_09520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QDI75971 LinkDB All DBs Position complement(1616909..1617142) Genome browser AA seq 77 aa AA seqDB search MSDVADRVKKIVVEHLGVEEDKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFISEAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgtcgcagatcgcgttaaaaagatcgttgttgagcacctgggtgttgaagag gacaaggtcaccgaaaacgcctccttcatcgacgatctgggcgcagacagcctggacacc gtggaactggtgatggcgtttgaagaagagttcggcatcgagatcccggacgacgcagcc gaaaccatccaaaccttcggcgacgcggtcaagttcatctccgaagcgtcctga

DBGET integrated database retrieval system