KEGG   Leisingera aquaemixtae: R2C4_13315
Entry
R2C4_13315        CDS       T06085                                 
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
laqu  Leisingera aquaemixtae
Pathway
laqu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:laqu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    R2C4_13315 (phnC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:laqu02000]
    R2C4_13315 (phnC)
Enzymes [BR:laqu01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     R2C4_13315 (phnC)
Transporters [BR:laqu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    R2C4_13315 (phnC)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_22 MMR_HSR1 SMC_N AAA_29 AAA_16 AAA_18 AAA_30 RsgA_GTPase DO-GTPase2 SbcC_Walker_B AAA_15 AAA_28 NB-ARC AAA_23 Dynamin_N Adeno_IVa2
Other DBs
NCBI-ProteinID: QDI76679
LinkDB
Position
complement(2385824..2386642)
AA seq 272 aa
MLRIDKLTKKFGGKIAVDAATLDIDKPCMIGIIGRSGAGKSTLLRMLNRLEDASAGRILF
EGREITGLKGKDKRAWQSDCAMIFQQFNLVPRMDVVSNVLHGTLNRRNAMATLFNLYPMD
DIHQAIDILDRLGIAEHAAKRAEALSGGQQQRVAIARALMQDPKIILADEPIASLDPMNA
QTVMEALRRIHEEDGRTVIANLHTLDTARRYCDRVVGMRDGRIVFDGLPEQLTTGVAREI
YGAGEAFSEAATSTEIETLEKTDALRAAIPAE
NT seq 819 nt   +upstreamnt  +downstreamnt
gtgctgcgcattgacaagctgacaaagaaattcggcggcaagattgcggtggatgccgcc
acgctggacatcgacaagccctgcatgatcggcatcatcggccgctccggcgcgggcaaa
tccactctgctgcggatgctgaaccggctggaggacgcaagcgctggccgcatcctgttc
gagggccgcgagatcaccgggctgaagggcaaagacaagcgcgcctggcagtccgactgc
gcgatgatctttcagcagttcaacctagtgccgcggatggatgtggtctccaacgtgctg
cacggcacgctgaaccgccgcaacgcgatggcgacgctgttcaacctctacccgatggat
gacatccaccaggcaattgatatcctggaccggctgggcatcgccgaacatgccgccaag
cgggccgaggcgctgtcgggggggcagcagcaacgggtggcgatcgcccgggcgctgatg
caggatccgaaaatcattctagcggatgagccgattgcctcgctcgatccgatgaatgcc
cagaccgtgatggaggcgctgcgccgcatccatgaggaagacggccgcaccgtcattgcc
aacctgcacacgctggacactgcgcgccggtattgcgaccgggttgtcggcatgcgcgac
gggcgcatcgtgtttgacggactgccggagcagctgaccacaggtgtggcccgcgagatt
tacggcgccggagaggcattctccgaggccgccacctcaaccgagattgaaacgctggaa
aagacggacgccctgcgcgccgccattcccgccgaataa

DBGET integrated database retrieval system