Lysobacter arenosi: HIV01_016855 Help Entry HIV01_016855      CDS       T07237                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism lare  Lysobacter arenosi Pathway lare00290   Valine, leucine and isoleucine biosynthesis lare00650   Butanoate metabolism lare00660   C5-Branched dibasic acid metabolism lare00770   Pantothenate and CoA biosynthesis lare01100   Metabolic pathways lare01110   Biosynthesis of secondary metabolites lare01210   2-Oxocarboxylic acid metabolism lare01230   Biosynthesis of amino acids Module lare_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine lare_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:lare00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     HIV01_016855    00660 C5-Branched dibasic acid metabolism     HIV01_016855   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     HIV01_016855   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     HIV01_016855 Enzymes [BR:lare01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      HIV01_016855 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 SbcD_C DUF3710 Motif Other DBs NCBI-ProteinID:  QSX74800 LinkDB All DBs Position complement(3670775..3671011) Genome browser AA seq 78 aa AA seqDB search MRYQLDLTLRQAEGALARVLGAAERRGFRPLAVDGEAQPDGDRWYLRLTVEGDRADTSLQ TQLAKLYDCLSVEVSPCQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcgataccagcttgatctcaccctgcgccaggccgaaggtgcgctggcgcgtgtactg ggcgccgccgaacgacgtggcttccgcccgctcgcggtcgatggcgaagcgcagcccgac ggcgaccgctggtacctgcgcctgaccgtcgaaggcgaccgcgccgacaccagcctgcag acacagctcgccaagctctacgactgcctctcggtggaggtgtcgccgtgtcaatga

DBGET integrated database retrieval system