Lawsonibacter asaccharolyticus: L9O85_00625 Help Entry L9O85_00625       CDS       T07961                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism lasa  Lawsonibacter asaccharolyticus Pathway lasa02024   Quorum sensing lasa03018   RNA degradation Brite KEGG Orthology (KO) [BR:lasa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     L9O85_00625 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     L9O85_00625 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:lasa03019]     L9O85_00625 (hfq)    03036 Chromosome and associated proteins [BR:lasa03036]     L9O85_00625 (hfq) Messenger RNA biogenesis [BR:lasa03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      L9O85_00625 (hfq) Chromosome and associated proteins [BR:lasa03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     L9O85_00625 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Phage_Hfq Motif Other DBs NCBI-ProteinID:  UMM46958 LinkDB All DBs Position complement(125967..126203) Genome browser AA seq 78 aa AA seqDB search MQKTNNLQEIFLTQVRRDRRPVTIFLMNGFQMRGYVTGFDAFTVVLTSDGKQQVIYKHAI STIVPERPVPLCQPGELE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcagaaaaccaacaatcttcaggagatcttcctcacccaggtccgccgggaccgccgc cccgtcaccatctttctgatgaacgggtttcagatgcggggctatgtcaccggctttgac gccttcaccgtggtcctcaccagcgatggcaagcagcaggtgatctacaagcacgccatc tccactatcgtcccggagcggcccgtccccctctgccagcccggcgagctggagtaa

DBGET integrated database retrieval system