Lysobacter auxotrophicus: LA521A_24760 Help Entry LA521A_24760      CDS       T09075                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism laux  Lysobacter auxotrophicus Brite KEGG Orthology (KO) [BR:laux00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:laux03032]     LA521A_24760    03036 Chromosome and associated proteins [BR:laux03036]     LA521A_24760    03400 DNA repair and recombination proteins [BR:laux03400]     LA521A_24760 DNA replication proteins [BR:laux03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     LA521A_24760 Chromosome and associated proteins [BR:laux03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     LA521A_24760 DNA repair and recombination proteins [BR:laux03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       LA521A_24760 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 DUF2267 HU-DNA_bdg VWA_3 Motif Other DBs NCBI-ProteinID:  BDU17275 UniProt:  A0ABN6ULR0 LinkDB All DBs Position complement(2779018..2779290) Genome browser AA seq 90 aa AA seqDB search MNKAEFVGAVAEAAELSKTDAANAVDAMINVVTKALKKGDTVTLVGFGTFQVRKRAARQG RNPKTGETIKIKASKNPSFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaggctgagtttgtcggcgccgtcgccgaggctgccgagctgtccaagaccgac gccgcgaacgccgtcgacgccatgatcaacgtggtcaccaaggcgctgaagaagggcgac accgtaacgctggtcggtttcggcacgttccaggttcgcaagcgcgccgcacgccagggc cgcaatccgaagacgggcgagaccatcaagatcaaggcgtcgaagaatccttcgttcaag gctggcaaggcgctgaaggatgccgtaaactaa

DBGET integrated database retrieval system