KEGG   Loxodonta africana (African savanna elephant): 100659051
Entry
100659051         CDS       T04351                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04062  Chemokine signaling pathway
lav04068  FoxO signaling pathway
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04137  Mitophagy - animal
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04218  Cellular senescence
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04371  Apelin signaling pathway
lav04540  Gap junction
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04625  C-type lectin receptor signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04714  Thermogenesis
lav04720  Long-term potentiation
lav04722  Neurotrophin signaling pathway
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04730  Long-term depression
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04912  GnRH signaling pathway
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04921  Oxytocin signaling pathway
lav04926  Relaxin signaling pathway
lav04929  GnRH secretion
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05034  Alcoholism
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05207  Chemical carcinogenesis - receptor activation
lav05208  Chemical carcinogenesis - reactive oxygen species
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05216  Thyroid cancer
lav05218  Melanoma
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100659051 (NRAS)
   04012 ErbB signaling pathway
    100659051 (NRAS)
   04014 Ras signaling pathway
    100659051 (NRAS)
   04015 Rap1 signaling pathway
    100659051 (NRAS)
   04370 VEGF signaling pathway
    100659051 (NRAS)
   04371 Apelin signaling pathway
    100659051 (NRAS)
   04068 FoxO signaling pathway
    100659051 (NRAS)
   04072 Phospholipase D signaling pathway
    100659051 (NRAS)
   04071 Sphingolipid signaling pathway
    100659051 (NRAS)
   04151 PI3K-Akt signaling pathway
    100659051 (NRAS)
   04150 mTOR signaling pathway
    100659051 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100659051 (NRAS)
   04137 Mitophagy - animal
    100659051 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    100659051 (NRAS)
   04218 Cellular senescence
    100659051 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100659051 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    100659051 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100659051 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100659051 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    100659051 (NRAS)
   04660 T cell receptor signaling pathway
    100659051 (NRAS)
   04662 B cell receptor signaling pathway
    100659051 (NRAS)
   04664 Fc epsilon RI signaling pathway
    100659051 (NRAS)
   04062 Chemokine signaling pathway
    100659051 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100659051 (NRAS)
   04929 GnRH secretion
    100659051 (NRAS)
   04912 GnRH signaling pathway
    100659051 (NRAS)
   04915 Estrogen signaling pathway
    100659051 (NRAS)
   04917 Prolactin signaling pathway
    100659051 (NRAS)
   04921 Oxytocin signaling pathway
    100659051 (NRAS)
   04926 Relaxin signaling pathway
    100659051 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    100659051 (NRAS)
   04919 Thyroid hormone signaling pathway
    100659051 (NRAS)
   04916 Melanogenesis
    100659051 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    100659051 (NRAS)
   04726 Serotonergic synapse
    100659051 (NRAS)
   04720 Long-term potentiation
    100659051 (NRAS)
   04730 Long-term depression
    100659051 (NRAS)
   04722 Neurotrophin signaling pathway
    100659051 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    100659051 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    100659051 (NRAS)
   04213 Longevity regulating pathway - multiple species
    100659051 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    100659051 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100659051 (NRAS)
   05206 MicroRNAs in cancer
    100659051 (NRAS)
   05205 Proteoglycans in cancer
    100659051 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    100659051 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    100659051 (NRAS)
   05203 Viral carcinogenesis
    100659051 (NRAS)
   05230 Central carbon metabolism in cancer
    100659051 (NRAS)
   05231 Choline metabolism in cancer
    100659051 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100659051 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100659051 (NRAS)
   05225 Hepatocellular carcinoma
    100659051 (NRAS)
   05226 Gastric cancer
    100659051 (NRAS)
   05214 Glioma
    100659051 (NRAS)
   05216 Thyroid cancer
    100659051 (NRAS)
   05221 Acute myeloid leukemia
    100659051 (NRAS)
   05220 Chronic myeloid leukemia
    100659051 (NRAS)
   05218 Melanoma
    100659051 (NRAS)
   05211 Renal cell carcinoma
    100659051 (NRAS)
   05219 Bladder cancer
    100659051 (NRAS)
   05215 Prostate cancer
    100659051 (NRAS)
   05213 Endometrial cancer
    100659051 (NRAS)
   05224 Breast cancer
    100659051 (NRAS)
   05223 Non-small cell lung cancer
    100659051 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100659051 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    100659051 (NRAS)
   05161 Hepatitis B
    100659051 (NRAS)
   05160 Hepatitis C
    100659051 (NRAS)
   05163 Human cytomegalovirus infection
    100659051 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100659051 (NRAS)
   05165 Human papillomavirus infection
    100659051 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100659051 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    100659051 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    100659051 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100659051 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100659051 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100659051 (NRAS)
   01522 Endocrine resistance
    100659051 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100659051 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100659051 (NRAS)
   04031 GTP-binding proteins [BR:lav04031]
    100659051 (NRAS)
Membrane trafficking [BR:lav04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    100659051 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100659051 (NRAS)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100659051 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   100659051 (NRAS)
  Exosomal proteins of breast cancer cells
   100659051 (NRAS)
  Exosomal proteins of colorectal cancer cells
   100659051 (NRAS)
GTP-binding proteins [BR:lav04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100659051 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 100659051
NCBI-ProteinID: XP_003409648
UniProt: G3TLL0
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgcactgaca
atccagctaatccagaaccattttgtagatgagtatgatcccaccatagaggattcatac
cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccagtacatgaggacaggcgaaggcttcctctgt
gtgtttgccatcaataatagcaaatcatttgcagatattaacctctacagggagcagatt
aaacgagtaaaagactcagatgatgtacctatggtgctggtgggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcgcatgaactggctaagagttatgggattccg
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaaaaaactcaacagcagcgatgatggaactcaaggt
tgtatggggctgccttgtgtggtgatgtaa

DBGET integrated database retrieval system