Novilysobacter avium: INQ42_02935 Help Entry INQ42_02935       CDS       T08144                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism lavi  Novilysobacter avium Pathway lavi00290   Valine, leucine and isoleucine biosynthesis lavi00650   Butanoate metabolism lavi00660   C5-Branched dibasic acid metabolism lavi00770   Pantothenate and CoA biosynthesis lavi01100   Metabolic pathways lavi01110   Biosynthesis of secondary metabolites lavi01210   2-Oxocarboxylic acid metabolism lavi01230   Biosynthesis of amino acids Module lavi_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine lavi_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:lavi00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     INQ42_02935    00660 C5-Branched dibasic acid metabolism     INQ42_02935   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     INQ42_02935   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     INQ42_02935 Enzymes [BR:lavi01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      INQ42_02935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  QOW22569 LinkDB All DBs Position complement(654390..654626) Genome browser AA seq 78 aa AA seqDB search MRYQIDLILRRAEGALARVIGTAERRGFQTVGVDGGLQPDGEHWHLRMNVEGQRCGDGLQ AQLHKLHDCLAVEVSPCR NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcgctaccagattgacctcatcctgcgccgcgccgagggcgcactggcccgggtgatc ggcaccgccgagcgccgcggcttccagaccgtcggcgtcgatggcggactccagcccgat ggcgagcactggcacctgcgcatgaacgtggaaggccagcgctgcggcgacggtctgcag gcccagctgcacaagctgcacgactgcctcgccgtggaggtctcgccatgtcgctga

DBGET integrated database retrieval system