Lactobacillus amylovorus GRL1118: LAB52_04840 Help Entry LAB52_04840       CDS       T01954                                  Name (GenBank) DNA-binding protein II HB   KO K03530   DNA-binding protein HU-beta Organism lay  Lactobacillus amylovorus GRL1118 Brite KEGG Orthology (KO) [BR:lay00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lay03032]     LAB52_04840    03036 Chromosome and associated proteins [BR:lay03036]     LAB52_04840    03400 DNA repair and recombination proteins [BR:lay03400]     LAB52_04840 DNA replication proteins [BR:lay03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     LAB52_04840 Chromosome and associated proteins [BR:lay03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     LAB52_04840 DNA repair and recombination proteins [BR:lay03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       LAB52_04840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_euk_1 HU-CCDC81_bac_2 DUF2267 Motif Other DBs NCBI-ProteinID:  AEA31924 LinkDB All DBs Position 953449..953724 Genome browser AA seq 91 aa AA seqDB search MANKAELVSEVASKTKLTKKEVAAAVDAIFGSIQDNLAKGEKVQLIGFGTFEVRHRAARK GRNPQTGDEIEIPASEVPAFKPGKALKEAVK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggcaaataaagctgaattagtttctgaagttgcttcaaagactaaattgactaagaag gaagttgctgctgctgttgatgctatctttggctcaatccaagacaaccttgctaagggt gaaaaggtacaattgatcggttttggtacttttgaagtacgccaccgtgcagcacgtaag ggtcgtaacccacaaactggtgatgaaatcgaaatcccagcaagtgaagtacctgcattc aagccaggtaaggctcttaaggaagctgttaagtag

DBGET integrated database retrieval system