Lactobacillus amylovorus GRL1118: LAB52_06735 Help Entry LAB52_06735       CDS       T01954                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lay  Lactobacillus amylovorus GRL1118 Pathway lay01100   Metabolic pathways lay01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lay00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LAB52_06735 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LAB52_06735 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 TerB PP-binding_2 Guanylate_cyc DUF4468 DUF1409 Motif Other DBs NCBI-ProteinID:  AEA32272 LinkDB All DBs Position complement(1320228..1320470) Genome browser AA seq 80 aa AA seqDB search MSKEEIFNKIKDLIAENFDVDKDKITESTSFTDDLDADSIDLVEFILQLEDEFGSEIPDE EAEKIKTVGDAVSYIESHQG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagaagagatttttaataagatcaaagatttgattgctgaaaattttgatgta gataaagacaagatcactgaaagtactagctttaccgacgatttggatgctgattcaatt gacctagtagaattcattttgcaacttgaagatgaattcggctcagaaatccctgatgaa gaagctgaaaagattaaaacagttggggatgcagtctcatatatcgagtctcatcaaggt taa

DBGET integrated database retrieval system