Lycium barbarum (goji berry): 132599326 Help Entry 132599326         CDS       T09483                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism lbb  Lycium barbarum (goji berry) Pathway lbb04145   Phagosome lbb04148   Efferocytosis lbb04620   Toll-like receptor signaling pathway lbb05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:lbb00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     132599326    04148 Efferocytosis     132599326  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     132599326  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     132599326  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lbb04131]     132599326   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lbb04147]     132599326    04031 GTP-binding proteins [BR:lbb04031]     132599326 Membrane trafficking [BR:lbb04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     132599326  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     132599326   Macropinocytosis    Ras GTPases     132599326  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     132599326 Exosome [BR:lbb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132599326   Exosomal proteins of other body fluids (saliva and urine)    132599326   Exosomal proteins of colorectal cancer cells    132599326   Exosomal proteins of bladder cancer cells    132599326 GTP-binding proteins [BR:lbb04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     132599326 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  132599326 NCBI-ProteinID:  XP_060168623 LinkDB All DBs Position 6:135943799..135949044 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL DLREDKQFFLDHPGAVPLTAAQGEELRKSIGAAAYIECSAKTQQNIKAVFDAAIKVVLQP PKQKKKKKRKGQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttctaggtttataaagtgtgttactgttggagatggagctgtgggtaaaact tgtcttctcatttcatataccagcaacacttttcccactgattatgtcccaactgtattt gacaattttagtgcaaatgtggtcgtcgatgggagcactgttaatctggggctctgggat actgcaggtcaggaagattacaatagattaagaccattgagctatcgtggggcagatgta tttatactagcattttctctcattagcaaggcgagctatgaaaatgtctccaaaaagtgg attcctgaattgaggcattatgctcctggagttccaattattcttgttggaacaaagcta gatctccgagaggataagcaattcttcttggaccatccaggtgctgttccacttaccgca gctcagggtgaggagctgagaaagtcgatcggtgctgctgcttacattgaatgtagtgca aaaacacaacagaatattaaggctgtttttgatgctgccattaaggtggttctacaacca cccaagcaaaagaagaagaagaagagaaagggtcagaaagcctgctctatcttgtga

DBGET integrated database retrieval system