Lycium barbarum (goji berry): 132600188 Help Entry 132600188         CDS       T09483                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism lbb  Lycium barbarum (goji berry) Pathway lbb04016   MAPK signaling pathway - plant lbb04070   Phosphatidylinositol signaling system lbb04075   Plant hormone signal transduction lbb04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:lbb00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     132600188    04070 Phosphatidylinositol signaling system     132600188    04075 Plant hormone signal transduction     132600188  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     132600188  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lbb01009]     132600188   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lbb04131]     132600188    03036 Chromosome and associated proteins [BR:lbb03036]     132600188   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lbb04147]     132600188 Protein phosphatases and associated proteins [BR:lbb01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      132600188 Membrane trafficking [BR:lbb04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     132600188 Chromosome and associated proteins [BR:lbb03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      132600188 Exosome [BR:lbb04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    132600188 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 SPARC_Ca_bdg SAPC2_N Dockerin_1 EH EF-hand_EFHB_C RNA_pol_Rpb4 TerB EF-hand_11 DUF5580_M EF_EFCAB10_C SPEF2_C PA_Ig-like EF-hand_STIM1 Sigma54_CBD EF-hand_SWAP70_N FAD-depend_C Motif Other DBs NCBI-GeneID:  132600188 NCBI-ProteinID:  XP_060169263 LinkDB All DBs Position 6:128106391..128107708 Genome browser AA seq 147 aa AA seqDB search MADALSEDQISEFREAFWVIDKDCDGVIRMEELAAVIQSLNEHPTKEEIQEMVNEVDPDG DGTIDFEDFLNIMARKLKDNVSEELKEAFKVFDRDQDGFISANELRNVMMNLGERLTDEE AQQMIREADLDGDGLVSYEEFVKIMII NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggctgatgcattgtcagaagaccaaatttctgagtttcgtgaagccttctgggttatc gataaggattgcgacggggtgataagaatggaggaacttgcggcagtaatccaatcttta aatgaacatccaactaaggaagagatacaagaaatggtaaacgaagtggatcctgatggt gatggcactattgattttgaagatttcttgaatatcatggctagaaagctcaaggacaac gtatcggaggagttaaaagaagcattcaaagtatttgatcgagatcaagatggatttatt tctgctaatgagttaagaaatgtgatgatgaatttgggagaaagattgacagatgaagaa gcccaacagatgatcagagaggcagatcttgatggagatggtctcgttagctatgaggaa tttgttaaaatcatgataatttaa

DBGET integrated database retrieval system