Lycium barbarum (goji berry): 132607674 Help Entry 132607674         CDS       T09483                                  Name (RefSeq) histone H2B.9-like   KO K11252   histone H2B Organism lbb  Lycium barbarum (goji berry) Brite KEGG Orthology (KO) [BR:lbb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lbb03036]     132607674   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lbb04147]     132607674 Chromosome and associated proteins [BR:lbb03036]  Eukaryotic type   Nucleosome assembly factors    Histones     132607674 Exosome [BR:lbb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132607674 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  132607674 NCBI-ProteinID:  XP_060177744 LinkDB All DBs Position 8:complement(9950770..9951230) Genome browser AA seq 97 aa AA seqDB search LILYVTSETYKIYIFKVLKQVHPDIGNSGKAMGIMNIFINDIFEKLAQETSKLARYDKKP TIMSGEIQTAVRLVLPDELAKHAVSEGTKAVTKFGSS NT seq 294 nt NT seq  +upstreamnt  +downstreamnt ttgatcttgtatgtcacttctgagacgtacaagatctatatattcaaagtgctaaaacaa gtgcatcctgatattggaaattcgggcaaagctatggggataatgaacatttttatcaac gatatatttgagaaactggcgcaagaaacttctaaacttgcgaggtatgataagaaacct acaattatgtctggggaaattcagaccgctgttagattggtgttgcctgatgaattggct aagcatgctgtttctgaaggaacaaaagcagttaccaagtttggtagctcttaa

DBGET integrated database retrieval system