Lycium barbarum (goji berry): 132609660 Help Entry 132609660         CDS       T09483                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism lbb  Lycium barbarum (goji berry) Pathway lbb03018   RNA degradation lbb03040   Spliceosome Brite KEGG Orthology (KO) [BR:lbb00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     132609660   09123 Folding, sorting and degradation    03018 RNA degradation     132609660  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:lbb03019]     132609660    03041 Spliceosome [BR:lbb03041]     132609660 Messenger RNA biogenesis [BR:lbb03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      132609660   mRNA degradation factors    5'-3' decay     Lsm complex      132609660 Spliceosome [BR:lbb03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     132609660  Complex C   U2 snRNP components     132609660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX DUF150_C LSM14 Motif Other DBs NCBI-GeneID:  132609660 NCBI-ProteinID:  XP_060179720 LinkDB All DBs Position 9:20208026..20213573 Genome browser AA seq 93 aa AA seqDB search MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDEDKYPHMRSVRNC FIRGSVVRYVQLPPDGVDIELLHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttgtttttctcatatttcaaggatctggtgggaagagaagtgactgtggaactgaag aacgatttggctatccgaggaacactacattcagttgatcagtatctaaacattaagctt gaaaacacgagggttgttgatgaggacaaatacccccacatgaggtcggtgaggaactgc ttcatcagaggatcggtggtgagatacgtgcagttgcctccagatggagttgacatagaa ttgcttcatgatgctacaaggagagaagctcgtggtggctga

DBGET integrated database retrieval system