Lycium barbarum (goji berry): 132615255 Help Entry 132615255         CDS       T09483                                  Name (RefSeq) SKP1-like protein 11   KO K03094   S-phase kinase-associated protein 1 Organism lbb  Lycium barbarum (goji berry) Pathway lbb03083   Polycomb repressive complex lbb04120   Ubiquitin mediated proteolysis lbb04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lbb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     132615255    04120 Ubiquitin mediated proteolysis     132615255   09126 Chromosome    03083 Polycomb repressive complex     132615255  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lbb04131]     132615255    04121 Ubiquitin system [BR:lbb04121]     132615255    03036 Chromosome and associated proteins [BR:lbb03036]     132615255 Membrane trafficking [BR:lbb04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     132615255 Ubiquitin system [BR:lbb04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      132615255    Cul7 complex      132615255 Chromosome and associated proteins [BR:lbb03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      132615255   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      132615255 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ DUF8207 HEXIM BTB DarP Arg_decarb_HB HTH_Tnp_ISL3 PRRSV_Env Motif Other DBs NCBI-GeneID:  132615255 NCBI-ProteinID:  XP_060185805 LinkDB All DBs Position 10:8122000..8123555 Genome browser AA seq 165 aa AA seqDB search MESSSLVTEQKKMLILKSSDGEYFELEESIAVQCGTIKNLVEDDFSHIPLPNVDAKTLRK IIEYMKKHAQKNDSNEEEIKDFDEKFVQGTFNDVYELLHAANYLHNSGLMDLLCQSIADR IKDKSVKAVREIFNVTNDYTPEEEAKVRMEHLWAHEGGEIDESLD NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atggagtcatcatcattagtaacagagcagaaaaagatgttgatattgaaatcctccgac ggcgaatattttgaattggaagaatccatcgccgttcaatgtggaaccatcaaaaacttg gtggaggacgatttcagccatatcccgctcccaaacgttgatgccaaaaccctaagaaaa attatcgaatacatgaagaagcacgctcagaagaatgattcgaacgaagaagaaatcaaa gatttcgacgagaaattcgtgcaaggtaccttcaacgacgtgtatgaacttttacatgca gcaaattaccttcacaatagtggtttgatggatctcttgtgccagtcgattgccgataga attaaggacaagtcggtaaaagctgttcgggagatattcaatgtcactaatgattacaca ccagaggaagaagcaaaggttcgtatggaacatctgtgggcgcatgaaggaggagaaatt gatgaatctcttgattag

DBGET integrated database retrieval system