Lycium barbarum (goji berry): 132622366 Help Entry 132622366         CDS       T09483                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism lbb  Lycium barbarum (goji berry) Pathway lbb03083   Polycomb repressive complex lbb04120   Ubiquitin mediated proteolysis lbb04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lbb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     132622366    04120 Ubiquitin mediated proteolysis     132622366   09126 Chromosome    03083 Polycomb repressive complex     132622366  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lbb04131]     132622366    04121 Ubiquitin system [BR:lbb04121]     132622366    03036 Chromosome and associated proteins [BR:lbb03036]     132622366 Membrane trafficking [BR:lbb04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     132622366 Ubiquitin system [BR:lbb04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      132622366    Cul7 complex      132622366 Chromosome and associated proteins [BR:lbb03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      132622366   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      132622366 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  132622366 NCBI-ProteinID:  XP_060192952 LinkDB All DBs Position 12:86096046..86096832 Genome browser AA seq 150 aa AA seqDB search MSSTKLLTLKTSDGEEFKLDEAIAVKSQAIKNMVEDDCVSNAIPLHNVDSKTMTKVIEYW KKHSEEGVSKDQLNDFDKGFLEVHHSVLYDLLLAANYLNDKELLDVICQEVADRIKGKTP EEIRKEFDIKNDFTPEEEEKIRQENAWAFD NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgtcttcaacaaagctcttaaccctaaaaactagcgatggtgaggaattcaaactggac gaggccatagccgtgaagtcacaagccatcaagaacatggttgaagacgactgcgtttca aacgccattcctctgcataatgtcgatagcaaaacaatgaccaaagtgatcgaatattgg aagaaacactcagaggaaggcgtctcgaaagaccagttgaatgattttgacaagggtttc ttggaggtgcaccactcggtgttgtacgatcttctcttagccgctaattatcttaatgat aaggagcttttagatgtaatatgccaagaagttgctgataggattaaagggaaaacacca gaggaaattcgtaaagaatttgatatcaagaatgattttactccagaggaagaggagaaa atccgccaagagaatgcttgggcttttgattga

DBGET integrated database retrieval system