Lycium barbarum (goji berry): 132632350 Help Entry 132632350         CDS       T09483                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism lbb  Lycium barbarum (goji berry) Pathway lbb04016   MAPK signaling pathway - plant lbb04070   Phosphatidylinositol signaling system lbb04075   Plant hormone signal transduction lbb04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:lbb00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     132632350    04070 Phosphatidylinositol signaling system     132632350    04075 Plant hormone signal transduction     132632350  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     132632350  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lbb01009]     132632350   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lbb04131]     132632350    03036 Chromosome and associated proteins [BR:lbb03036]     132632350   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lbb04147]     132632350 Protein phosphatases and associated proteins [BR:lbb01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      132632350 Membrane trafficking [BR:lbb04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     132632350 Chromosome and associated proteins [BR:lbb03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      132632350 Exosome [BR:lbb04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    132632350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF-hand_9 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M Dockerin_1 Caleosin EFhand_Ca_insen SPEF2_C SurA_N_3 FCaBP_EF-hand MotA_activ Poly_export Fe_hyd_lg_C DUF6279 MecA_N PhageMin_Tail Motif Other DBs NCBI-GeneID:  132632350 NCBI-ProteinID:  XP_060204232 LinkDB All DBs Position 3:127041334..127045373 Genome browser AA seq 149 aa AA seqDB search MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQ NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVRMMLAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagagcagcttactgaggaacagatcgctgagtttaaggaagcttttagccttttc gacaaagatggcgatggctgtattactaccaaggagttgggaacagtgatgagatcactt ggtcagaatcccactgaagctgaactgcaggatatgatcagcgaagttgatgctgatcag aatggaactattgattttccagagttcttgaatctgatggcacgtaagatgaaggacacc gattctgaggaggaactgaaagaagctttcaaggtttttgataaagatcagaatggcttt atctctgctgctgagcttcgtcatgtaatgacaaacctcggagagaagctgactgatgaa gaggtggatgagatgatccgagaggcagatattgatggtgatgggcaagttaattacgag gagtttgtccgcatgatgcttgccaagtga

DBGET integrated database retrieval system