Lycium barbarum (goji berry): 132635332 Help Entry 132635332         CDS       T09483                                  Name (RefSeq) sm-like protein LSM5   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism lbb  Lycium barbarum (goji berry) Pathway lbb03018   RNA degradation lbb03040   Spliceosome Brite KEGG Orthology (KO) [BR:lbb00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     132635332   09123 Folding, sorting and degradation    03018 RNA degradation     132635332  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:lbb03019]     132635332    03041 Spliceosome [BR:lbb03041]     132635332 Messenger RNA biogenesis [BR:lbb03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      132635332   mRNA degradation factors    5'-3' decay     Lsm complex      132635332 Spliceosome [BR:lbb03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     132635332 SSDB OrthologParalogGFIT Motif Pfam:  LSM DUF7452 Ntox4 Motif Other DBs NCBI-GeneID:  132635332 NCBI-ProteinID:  XP_060207650 LinkDB All DBs Position 4:15313468..15317098 Genome browser AA seq 88 aa AA seqDB search MSSNNPSQLLPSELIDRCIGSKIWVIMKGDKELVGTLRGFDVYVNMVLEDVTEYEITSEG RRITKLDQILLNGNNIAILVPGGSPPDE NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtcttcaaacaacccttctcagctacttccatctgagttgattgatcgttgcattggt tcaaagatatgggtaataatgaaaggtgataaggaacttgttggtacacttagaggcttt gatgtttatgttaacatggttcttgaagatgttactgaatatgagatcacttctgaaggg cggcggataacaaaacttgatcagatattgcttaatggaaacaatattgctatcctggtt cctggtgggtcaccacctgatgagtga

DBGET integrated database retrieval system