Lycium barbarum (goji berry): 132637692 Help Entry 132637692         CDS       T09483                                  Name (RefSeq) SKP1-like protein 11   KO K03094   S-phase kinase-associated protein 1 Organism lbb  Lycium barbarum (goji berry) Pathway lbb03083   Polycomb repressive complex lbb04120   Ubiquitin mediated proteolysis lbb04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lbb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     132637692    04120 Ubiquitin mediated proteolysis     132637692   09126 Chromosome    03083 Polycomb repressive complex     132637692  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lbb04131]     132637692    04121 Ubiquitin system [BR:lbb04121]     132637692    03036 Chromosome and associated proteins [BR:lbb03036]     132637692 Membrane trafficking [BR:lbb04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     132637692 Ubiquitin system [BR:lbb04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      132637692    Cul7 complex      132637692 Chromosome and associated proteins [BR:lbb03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      132637692   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      132637692 SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  132637692 NCBI-ProteinID:  XP_060210729 LinkDB All DBs Position 4:115913257..115913691 Genome browser AA seq 144 aa AA seqDB search MAASALQTIEKRFLTLKSSYGDVFELYESISIKSLTIKKMVEDGRVIGIIPLFKVSTEIL ATIIKYRKMHHLTSNQKETNNYDKGFVDTSFKTLFNVLSAENFLDIKGLLDLGVQAVGDR IKHKSLRLFKRYLILLVISHHRRK NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atggcagcgtcagcattacaaaccatagagaagaggtttttgacgttgaaatcctcatat ggtgatgtgtttgaattgtatgaatccatttccattaagtcattgacgatcaagaaaatg gttgaagatggacgcgtcattggcatcatcccactctttaaagttagcacagaaatccta gccacgatcattaaataccgcaaaatgcatcacttaacatcaaaccaaaaagaaacaaat aattacgacaagggatttgtggatactagcttcaaaaccctctttaacgtcttatcagcc gaaaatttcctcgacatcaagggtctgctcgatttgggcgttcaggcagtaggtgacagg atcaagcataagtcgctgaggctgttcaagagatatttaatattattagtgatttcacac catagaagaaaatga

DBGET integrated database retrieval system