Lycium barbarum (goji berry): 39333080 Help Entry 39333080          CDS       T09483                                  Symbol atpH, E2270_pgp080 Name (RefSeq) AtpH   KO K02110   F-type H+-transporting ATPase subunit c Organism lbb  Lycium barbarum (goji berry) Pathway lbb00190   Oxidative phosphorylation lbb00195   Photosynthesis lbb01100   Metabolic pathways Module lbb_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:lbb00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     39333080 (atpH)    00195 Photosynthesis     39333080 (atpH)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:lbb00194]     39333080 (atpH) Photosynthesis proteins [BR:lbb00194]  Photosystem and electron transport system   F-type ATPase [OT]    39333080 (atpH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-GeneID:  39333080 NCBI-ProteinID:  YP_009561814 UniProt:  A0A410SNJ6 LinkDB All DBs Position Pltd:complement(13355..13600) Genome browser AA seq 81 aa AA seqDB search MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaatccactgatttctgccgcttccgttattgctgctggattggccgtagggcttgct tctattggacctggagttggtcaagggactgctgcgggtcaagctgtagagggtatcgcg agacagcctgaggcagagggaaaaatacgaggtacgctattgcttagtctagcttttatg gaagctttaacaatttatggactggttgtagcattagcacttttatttgcaaatcctttt gtttaa

DBGET integrated database retrieval system