Laccaria bicolor: LACBIDRAFT_254168 Help Entry LACBIDRAFT_254168 CDS       T01044                                  Name (RefSeq) hypothetical protein   KO K10419   dynein light chain roadblock-type Organism lbc  Laccaria bicolor Pathway lbc04814   Motor proteins Brite KEGG Orthology (KO) [BR:lbc00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     LACBIDRAFT_254168  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lbc04131]     LACBIDRAFT_254168   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lbc03037]     LACBIDRAFT_254168    04812 Cytoskeleton proteins [BR:lbc04812]     LACBIDRAFT_254168 Membrane trafficking [BR:lbc04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     LACBIDRAFT_254168 Cilium and associated proteins [BR:lbc03037]  Motile cilia and associated proteins   Dynein arm    LACBIDRAFT_254168 Cytoskeleton proteins [BR:lbc04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      LACBIDRAFT_254168 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Robl_LC7 Motif Other DBs NCBI-GeneID:  6082828 NCBI-ProteinID:  XP_001887182 JGI:  254168 UniProt:  B0DT93 LinkDB All DBs AA seq 98 aa AA seqDB search MPPELEQTLSLLSSHRSVLGYILVARGHHPSIIRHSGVVFEGEQGKRYAAAVARIVESVQ GGLEEDEVRFMRIRTKRHELMISPDDRYLLAVLHDPAT NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgccgcctgaactagagcagacattatctctgctatcatcgcatcgttctgtgctcggt tacatacttgtcgcgcggggacaccatccaagcataattcgccactctggggtcgtcttt gaaggtgaacaagggaagagatacgctgctgccgtcgcgcgtattgtggagagcgtgcaa ggaggcttggaagaagatgaagtgcgctttatgagaatacggacgaagcgacatgaactt atgatttcccctgacgatcggtatctgctagctgtgcttcacgatccagcaacatga

DBGET integrated database retrieval system