Leptopilina boulardi: 127277834 Help Entry 127277834         CDS       T08910                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism lbd  Leptopilina boulardi Pathway lbd04013   MAPK signaling pathway - fly lbd04145   Phagosome lbd04148   Efferocytosis lbd04310   Wnt signaling pathway lbd04620   Toll-like receptor signaling pathway lbd05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:lbd00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     127277834    04310 Wnt signaling pathway     127277834  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     127277834    04148 Efferocytosis     127277834  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     127277834  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     127277834  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lbd04131]     127277834   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lbd04147]     127277834    04031 GTP-binding proteins [BR:lbd04031]     127277834 Membrane trafficking [BR:lbd04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     127277834  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     127277834   Macropinocytosis    Ras GTPases     127277834  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     127277834 Exosome [BR:lbd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127277834   Exosomal proteins of other body fluids (saliva and urine)    127277834   Exosomal proteins of colorectal cancer cells    127277834   Exosomal proteins of bladder cancer cells    127277834 GTP-binding proteins [BR:lbd04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     127277834 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  127277834 NCBI-ProteinID:  XP_051155185 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLAMAKEISAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKSKRKCCLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcaattaagtgcgtggttgtaggtgatggagctgtgggtaaaacgtgtttattg atcagctacacaacaaatgcttttccaggcgaatacatacctacagtatttgacaattat tctgctaatgtaatggtagatggtaaaccaataaatcttggtctatgggatacggctggt caggaagattacgacagattacgaccactgtcgtatcctcaaactgatgttttcttaatt tgtttttcattggtgaatcccgcaagttttgaaaacgttcgagccaaatggtatccggag gttcgtcatcattgcccagctactcctataatattggttggaactaaattagatttgcgt gaagataaagaaactattgaacgattaaaggataaaaaacttgcacctataacatatcct cagggtttggccatggcaaaagaaattagtgcggtgaaatatttggaatgctcagcttta acgcaaaaaggattgaaaacagtttttgacgaggcaattcgagcagtcctttgtcccgtt ctccaagtaaagtcgaaacgcaaatgttgcctcctataa

DBGET integrated database retrieval system