Leptopilina boulardi: 127277834 Help Entry 127277834         CDS       T08910                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism lbd  Leptopilina boulardi Pathway lbd04013   MAPK signaling pathway - fly lbd04145   Phagosome lbd04148   Efferocytosis lbd04310   Wnt signaling pathway lbd04517   IgSF CAM signaling lbd04518   Integrin signaling lbd04620   Toll-like receptor signaling pathway lbd05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:lbd00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     127277834    04310 Wnt signaling pathway     127277834   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     127277834    04518 Integrin signaling     127277834  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     127277834    04148 Efferocytosis     127277834  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     127277834  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     127277834  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lbd04131]     127277834   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lbd04147]     127277834    04031 GTP-binding proteins [BR:lbd04031]     127277834 Membrane trafficking [BR:lbd04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     127277834  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     127277834   Macropinocytosis    Ras GTPases     127277834  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     127277834 Exosome [BR:lbd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127277834   Exosomal proteins of other body fluids (saliva and urine)    127277834   Exosomal proteins of colorectal cancer cells    127277834   Exosomal proteins of bladder cancer cells    127277834 GTP-binding proteins [BR:lbd04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     127277834 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  127277834 NCBI-ProteinID:  XP_051155185 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLAMAKEISAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKSKRKCCLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcaattaagtgcgtggttgtaggtgatggagctgtgggtaaaacgtgtttattg atcagctacacaacaaatgcttttccaggcgaatacatacctacagtatttgacaattat tctgctaatgtaatggtagatggtaaaccaataaatcttggtctatgggatacggctggt caggaagattacgacagattacgaccactgtcgtatcctcaaactgatgttttcttaatt tgtttttcattggtgaatcccgcaagttttgaaaacgttcgagccaaatggtatccggag gttcgtcatcattgcccagctactcctataatattggttggaactaaattagatttgcgt gaagataaagaaactattgaacgattaaaggataaaaaacttgcacctataacatatcct cagggtttggccatggcaaaagaaattagtgcggtgaaatatttggaatgctcagcttta acgcaaaaaggattgaaaacagtttttgacgaggcaattcgagcagtcctttgtcccgtt ctccaagtaaagtcgaaacgcaaatgttgcctcctataa

DBGET integrated database retrieval system