Leptopilina boulardi: 127280645 Help Entry 127280645         CDS       T08910                                  Name (RefSeq) LIRP-like   KO K04526   insulin Organism lbd  Leptopilina boulardi Pathway lbd04068   FoxO signaling pathway lbd04081   Hormone signaling lbd04140   Autophagy - animal lbd04150   mTOR signaling pathway lbd04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:lbd00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     127280645    04150 mTOR signaling pathway     127280645   09133 Signaling molecules and interaction    04081 Hormone signaling     127280645  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127280645  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     127280645  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lbd04052]     127280645 Cytokines and neuropeptides [BR:lbd04052]  Neuropeptides   Unclassified    127280645 SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  127280645 NCBI-ProteinID:  XP_051159754 LinkDB All DBs Position Unknown AA seq 132 aa AA seqDB search MSTHRLYVLVTLVLAASLIIPQLVKAQLDLLQNVQKRSVVNQHYCGNRLSNALQLFCNGQ YYSMFKKSGQEMEVDETPFAYDEMYPFRSRQSANAMIGRFGGGRFRRYSRGVHDECCAKP CSIDELTSYCGF NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgtccacgcatcggttatacgttctagtaacactcgtgcttgctgcgtcgcttattatt ccgcaattggttaaagctcaattggatctccttcaaaatgttcaaaaacgatcggtggtg aatcaacattattgtggaaatcgtctttcaaatgctttacaactcttctgcaatggtcaa tactattcaatgttcaaaaaaagcggtcaagaaatggaggtagacgaaacgccatttgcc tatgatgaaatgtatcccttcagatccagacaaagtgcaaacgcaatgattggtagattt ggcggtggtcgatttagaagatattcacgcggtgtccacgacgagtgttgcgcaaaacca tgtagtatcgatgaattaaccagctattgtggcttttaa

DBGET integrated database retrieval system