Leptopilina boulardi: 127289343 Help Entry 127289343         CDS       T08910                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism lbd  Leptopilina boulardi Pathway lbd04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:lbd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     127289343  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lbd04121]     127289343    03400 DNA repair and recombination proteins [BR:lbd03400]     127289343 Ubiquitin system [BR:lbd04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      127289343    Cul5 complex      127289343 DNA repair and recombination proteins [BR:lbd03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      127289343 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  127289343 NCBI-ProteinID:  XP_051173177 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MDVFLMIRRKKMTIFTDAKDNTTVLELKKIIEGILKIPPVNQQLFNKDNVVMTDCKCLGE YGLTPTTAKAQCPALIGLAIRQDSGNFENLEMTPFSLPPDLPDVMKSQETNGQEQSP NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggatgtatttctaatgattcgacgaaaaaagatgacgatattcaccgatgcaaaagat aatacaactgttcttgagcttaaaaaaattattgaaggtatactaaaaattccaccggtc aatcaacaactttttaataaagataatgtggtaatgaccgattgtaaatgtctcggtgaa tatggattaacaccaacaactgcaaaagcacaatgtccagcattaataggtctcgcaatt cgtcaggattcgggaaatttcgaaaatttagaaatgactcccttctctttgccacctgat cttcctgatgtgatgaaatcacaagaaaccaatggacaagaacaatctccttga

DBGET integrated database retrieval system