KEGG   Lentilactobacillus buchneri NRRL B-30929: Lbuc_0746
Entry
Lbuc_0746         CDS       T01477                                 
Name
(GenBank) Phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
lbh  Lentilactobacillus buchneri NRRL B-30929
Pathway
lbh00770  Pantothenate and CoA biosynthesis
lbh01100  Metabolic pathways
lbh01240  Biosynthesis of cofactors
Module
lbh_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:lbh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Lbuc_0746
Enzymes [BR:lbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     Lbuc_0746
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig Se-cys_synth_N Ribosomal_L4
Other DBs
NCBI-ProteinID: AEB73010
LinkDB
Position
793553..794032
AA seq 159 aa
MTKALYAGSFDPITFGHIDVIKRASRIFDKVYVAISINTHKHALFTDEERAEFARQALNQ
LPNVDVVVSEELTVQLAHSLGATVLVRGVRGGSDLDSEMSIAGLNEKLADDIQTIFIPTA
ANYRDLSSSMIKEIAKFHGDVSKFVPGPVAQALNDKYQQ
NT seq 480 nt   +upstreamnt  +downstreamnt
atgacaaaagctttatatgcaggtagttttgacccgatcaccttcggtcacattgatgtc
atcaaacgggccagccgaatttttgacaaggtgtacgttgctatcagtattaacacccac
aaacatgctttgttcaccgatgaggagcgggctgagtttgcccgccaggcattaaatcag
ttacccaatgtcgacgttgtggtctctgaagagctgaccgtccagcttgcccattccttg
ggcgcaacggtcttagtcagaggcgttcgcggcggcagtgacctggattccgagatgtca
atcgcggggcttaacgagaagttggccgacgatattcaaaccatttttatcccaaccgcg
gccaactatcgcgacctctcatcgagtatgatcaaagagatcgctaagttccatggcgat
gtatcaaaatttgttccaggacctgttgcacaggcattgaatgacaagtatcaacaataa

DBGET integrated database retrieval system