Leptospira borgpetersenii JB197: LBJ_1643
Help
Entry
LBJ_1643 CDS
T00404
Name
(GenBank) Conserved hypothetical protein
KO
K06891
ATP-dependent Clp protease adaptor protein ClpS
Organism
lbj
Leptospira borgpetersenii JB197
Brite
KEGG Orthology (KO) [BR:
lbj00001
]
09190 Not Included in Pathway or Brite
09192 Unclassified: genetic information processing
99975 Protein processing
LBJ_1643
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ClpS
RNA_pol_Rpc34
Yop-YscD_ppl_3rd
Motif
Other DBs
NCBI-ProteinID:
ABJ76200
UniProt:
Q04SC0
LinkDB
All DBs
Position
1:complement(1935561..1935875)
Genome browser
AA seq
104 aa
AA seq
DB search
MASTQTPDLDEITSTKSTGGPWRVVLWDDNEHTYEYVIEMLVEICMMTVEKAFLHAVQVD
QEKRTIVFSGEFEHAEHVQERILTYGADPRMSNSKGSMSATLEK
NT seq
315 nt
NT seq
+upstream
nt +downstream
nt
atggcgagcacacaaactcctgacttagatgagattacctccacaaagtctacgggagga
ccttggagggtggttctttgggacgataacgagcatacctacgaatatgttatcgaaatg
ctcgtggaaatttgtatgatgactgtcgaaaaggcgttcttgcatgcagttcaagtcgat
caagaaaaacgtacaatcgttttttccggggagttcgagcacgcggaacacgtccaagaa
agaattctcacctatggagccgatccgagaatgtccaactctaaaggttccatgagcgct
actctagaaaagtaa
DBGET
integrated database retrieval system