Leptospira borgpetersenii JB197: LBJ_2112 Help Entry LBJ_2112          CDS       T00404                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism lbj  Leptospira borgpetersenii JB197 Pathway lbj01100   Metabolic pathways lbj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lbj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LBJ_2112 (acpP)    00074 Mycolic acid biosynthesis     LBJ_2112 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LBJ_2112 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ABJ76607 UniProt:  Q04R63 LinkDB All DBs Position 1:complement(2494942..2495175) Genome browser AA seq 77 aa AA seqDB search MADFEKVKSIIVEQLGVDESEVTPEAHFIDDLGADSLDTVELVMALEEEFGIEISDEDAE KIQTVGDVTKFIDNLKS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagactttgaaaaagttaaatctattatcgtagaacaacttggagtggatgaatct gaagttacacctgaggctcacttcatcgacgacctcggtgcggattctctagatacggtt gaattagtgatggctcttgaagaagaattcggaatcgaaatctctgacgaagacgctgaa aaaattcaaactgtcggggacgtaactaagttcatcgacaacctcaagtcctaa

DBGET integrated database retrieval system