Leptolyngbya boryana: LBWT_7260 Help Entry LBWT_7260         CDS       T04848                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism lbo  Leptolyngbya boryana Pathway lbo01100   Metabolic pathways lbo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lbo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LBWT_7260    00074 Mycolic acid biosynthesis     LBWT_7260   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LBWT_7260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BAS54828 LinkDB All DBs Position complement(793275..793529) Genome browser AA seq 84 aa AA seqDB search MAITETQIQETMFKLLQKIAPGSSPETLGKDDDVRETLGIDSYDFLNFMIGLNEEFGVET PETDYGKLITLNDIVQYISTHAQQ NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcaatcactgaaactcaaattcaagaaacaatgttcaaactcttgcaaaagattgct cctgggtcttctccagaaactctaggcaaggatgatgatgttcgagaaacgctcggaatt gattcttatgattttctcaatttcatgattgggctaaatgaggaatttggtgtggagact ccagaaaccgactatggaaaactcatcacgcttaacgatatcgttcagtatatttctact cacgctcaacagtaa

DBGET integrated database retrieval system