Lachnospiraceae bacterium JLR.KK008: V1224_12895 Help Entry V1224_12895       CDS       T10585                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lbp  Lachnospiraceae bacterium JLR.KK008 Pathway lbp00998   Biosynthesis of various antibiotics lbp01100   Metabolic pathways lbp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lbp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     V1224_12895    00074 Mycolic acid biosynthesis     V1224_12895   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     V1224_12895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WWR15359 LinkDB All DBs Position complement(2583672..2583911) Genome browser AA seq 79 aa AA seqDB search MTREEVFAGVNEVFRDIFDDEEITVGETTTADDIEDWDSLEHINLIVAIEKKFGMKFTMG EATTMEHVGAMVDIILERI NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgacaagagaagaagtgtttgcaggggtaaacgaagtgtttcgcgatatttttgacgac gaggagattacggtaggggaaacaacaacggcggacgatattgaggactgggacagcctg gagcatatcaatctgatcgtggccatagagaaaaagttcgggatgaaatttacgatggga gaggcgacgacaatggaacatgtcggcgccatggtagatattattttggagagaatttaa

DBGET integrated database retrieval system