Leadbetterella byssophila: Lbys_1476 Help Entry Lbys_1476         CDS       T01350                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism lby  Leadbetterella byssophila Pathway lby01100   Metabolic pathways lby01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lby00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Lbys_1476    00074 Mycolic acid biosynthesis     Lbys_1476   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Lbys_1476 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ADQ17190 UniProt:  E4RWY4 LinkDB All DBs Position 1529564..1529809 Genome browser AA seq 81 aa AA seqDB search MTKEEIIEITNGFLSEEFEVDIDTLRPEAILKDTLGLDSLDYVDLVVTVQSHFGVKLGEA DFVGISTFEDFYRLIERKIAQ NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacgaaggaagaaataatagaaataacgaacggttttctatcagaagaatttgaagta gatattgacaccctccggcctgaggccattttaaaagatactttaggtctggatagtttg gactatgtagacttggtggttaccgtacagtcccacttcggagtaaagttgggagaagct gactttgttggcatttcaacatttgaagacttttatcgccttattgaaagaaaaattgcc caatga

DBGET integrated database retrieval system