Leishmania braziliensis: LBRM_19_1220 Help Entry LBRM_19_1220      CDS       T01113                                  Name (RefSeq) putative dynein light chain   KO K10418   dynein light chain LC8-type Organism lbz  Leishmania braziliensis Pathway lbz04145   Phagocytosis lbz04517   IgSF CAM signaling lbz04814   Motor proteins Brite KEGG Orthology (KO) [BR:lbz00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     LBRM_19_1220  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     LBRM_19_1220   09142 Cell motility    04814 Motor proteins     LBRM_19_1220  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lbz03037]     LBRM_19_1220    04812 Cytoskeleton proteins [BR:lbz04812]     LBRM_19_1220 Cilium and associated proteins [BR:lbz03037]  Motile cilia and associated proteins   Dynein arm    LBRM_19_1220 Cytoskeleton proteins [BR:lbz04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      LBRM_19_1220 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light LPMO11_C Abhydrolase_1 Motif Other DBs NCBI-GeneID:  5414759 NCBI-ProteinID:  XP_001564217 UniProt:  A4HA47 LinkDB All DBs Position 19:459390..459728 Genome browser AA seq 112 aa AA seqDB search MSGTKVLIKESAMPVDMQQDCADCAAHALFTLKLHEQTELAQFIKKELDIKYGGQWHCIV GHSFGSCVGHDEAFFVYFEINSIFFSMWRMNKTLEAKQVSIDNAGRIVQATT NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgtctggaacgaaggtcctcatcaaagagtccgccatgccggtggatatgcaacaagac tgcgccgactgcgccgcacacgcgctcttcaccttgaagctacacgaacaaaccgaactc gctcagttcatcaagaaggagctggatatcaagtacggcgggcagtggcactgcatcgtc ggacactcttttggttcctgcgtcggccatgatgaggcgttcttcgtgtactttgagatc aacagcatcttctttagcatgtggaggatgaacaagacgctcgaagcgaagcaggtgtcg atcgacaatgcagggcgcattgtgcaggctaccacctag

DBGET integrated database retrieval system