Leishmania braziliensis: LBRM_20_4000 Help Entry LBRM_20_4000      CDS       T01113                                  Name (RefSeq) conserved hypothetical protein   KO K16780   sjoegren syndrome nuclear autoantigen 1 Organism lbz  Leishmania braziliensis Brite KEGG Orthology (KO) [BR:lbz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lbz03036]     LBRM_20_4000   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lbz03037]     LBRM_20_4000 Chromosome and associated proteins [BR:lbz03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     LBRM_20_4000 Cilium and associated proteins [BR:lbz03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    LBRM_20_4000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ADIP Tom22 DUF3450 IFT57 HMMR_C CC4_CEP85 CCDC28 PDC10_C COG6_N Lebercilin CorA Leu_zip Occludin_ELL OmpH BRE1 ERM_helical SKA2 FliD_N GAS FUSC DUF1664 CCDC113_CCDC96_CC Sec20 YabA ABC_tran_CTD USP8_interact Lectin_N Prefoldin_2 Motif Other DBs NCBI-GeneID:  5415231 NCBI-ProteinID:  XP_001564680 UniProt:  A4HBG0 A0A3P3Z5D0 LinkDB All DBs Position 20_and_34a:1543154..1543480 Genome browser AA seq 108 aa AA seqDB search MAALGSDVQATSVELVSVIEKMKERKARLEEQISAEEAEYEGLLAEVRTMQERLAALRDS VAKKQAVRADLERTISETYSAFKSILDASKKLLSTAKEESSALKSQIE NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggctgccctcgggtcagatgtgcaagccaccagtgtcgagctggtctctgtgattgag aaaatgaaggagcgcaaggcgcggcttgaagagcaaatctctgccgaggaggccgagtac gaaggcttgcttgccgaagtacgcacgatgcaggagcgactcgcagccctcagagacagt gtcgcgaagaagcaggcggtgcgcgcagacttggagcgaaccatatcggagacgtactcg gcattcaagagcatcctggatgcttcgaagaagctgttgtccactgccaaggaggagtca tcggcactcaagtcacaaatagagtga

DBGET integrated database retrieval system