Leisingera caerulea: K3721_08690 Help Entry K3721_08690       CDS       T08528                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lcae  Leisingera caerulea Pathway lcae00998   Biosynthesis of various antibiotics lcae01100   Metabolic pathways lcae01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lcae00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K3721_08690    00074 Mycolic acid biosynthesis     K3721_08690   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K3721_08690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  UWQ55602 UniProt:  A0A9Q9HP04 LinkDB All DBs Position complement(1752481..1752738) Genome browser AA seq 85 aa AA seqDB search MSTQDKVIAIIAEQAVLEPSDVTLDSTLEDLGIDSLGLVESIFAIEEEFDISIPFNANEP GKSDFDISNVAAIVAGIDKLILEKA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcacgcaggacaaggtcattgcaatcattgccgaacaggcggttctggagccttcg gatgtgaccctcgacagcaccctggaggatcttggcatcgacagcctggggctggttgaa agcatcttcgcgatcgaggaggagttcgacatttcgattcccttcaacgccaacgagcct gggaaaagcgatttcgacatctccaatgtggcggccatcgtcgcgggcatcgacaagctg atactggaaaaggcgtaa

DBGET integrated database retrieval system