Leisingera caerulea: K3721_17420 Help Entry K3721_17420       CDS       T08528                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism lcae  Leisingera caerulea Brite KEGG Orthology (KO) [BR:lcae00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:lcae03110]     K3721_17420 (grxC) Chaperones and folding catalysts [BR:lcae03110]  Protein folding catalysts   Protein disulfide isomerase    K3721_17420 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR Thioredoxin_2 DUF1223 Motif Other DBs NCBI-ProteinID:  UWQ53735 UniProt:  A0A9Q9LWI9 LinkDB All DBs Position complement(3607305..3607562) Genome browser AA seq 85 aa AA seqDB search MKTVEIYTSPLCGYCHAAKRLLNQKGVAFSEVNVLEQPERKAEMIQRANGGRTVPQIFIG DTHVGGCDDLFALEQAGKLDPLLAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaaaacggttgaaatctacacctcgcctctgtgcggctactgccatgcggccaaacgg ttgctgaaccagaaaggcgtggctttttcagaagttaacgttctggagcagccggagcgc aaggcagagatgatccagcgcgccaacggcggccgcacagtgccgcagatcttcatcggc gatacccacgtgggcggctgtgacgacctttttgcgctggaacaggcgggaaagctcgac ccgctgctggcggcctga

DBGET integrated database retrieval system