Leisingera caerulea: K3721_21905 Help Entry K3721_21905       CDS       T08528                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lcae  Leisingera caerulea Pathway lcae00998   Biosynthesis of various antibiotics lcae01100   Metabolic pathways lcae01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lcae00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K3721_21905    00074 Mycolic acid biosynthesis     K3721_21905   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K3721_21905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UWQ56530 UniProt:  A0A9Q9HQS4 LinkDB All DBs Position unnamed7:complement(43744..43995) Genome browser AA seq 83 aa AA seqDB search MTQTDMRAVFLEELTRVAPDIDPAGVSDGDHLQDDLELDSMDILNLAAALHQRLGIEIPE ADYPRIATVGAAAAYLSAAAAAD NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacccagaccgacatgcgtgccgttttcctggaagagctgacacgggtggcccccgat attgaccccgctggggtgtccgatggggatcatctgcaggatgatctggagctggattcg atggatatcctgaatctggcggcggccctgcaccagcggcttggcatcgaaatcccggag gcggattatccccggatcgcaacggtgggggccgccgctgcctatctttctgccgcggcg gctgcggattag

DBGET integrated database retrieval system