Leptogranulimonas caecicola: ATTO_10750 Help Entry ATTO_10750        CDS       T08581                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism lcal  Leptogranulimonas caecicola Pathway lcal03430   Mismatch repair Brite KEGG Orthology (KO) [BR:lcal00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     ATTO_10750  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:lcal03400]     ATTO_10750 Enzymes [BR:lcal01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      ATTO_10750 DNA repair and recombination proteins [BR:lcal03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      ATTO_10750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S CCDC113_CCDC96_CC Motif Other DBs NCBI-ProteinID:  BDC91203 UniProt:  A0AAU9CL74 LinkDB All DBs Position complement(1237378..1237647) Genome browser AA seq 89 aa AA seqDB search MDTSMPYQNSNSSDAYELNAAPVEELSFKQASIELEHIVSALENGSLELEAALDYYRRGV ELLSSLRERLATAEQQVQVLYDASASNQG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggatacttcaatgccctatcaaaatagtaactctagcgacgcctatgagctgaatgcc gctcccgtggaagagctgtcgttcaagcaagcctccattgagctggaacacattgtgtct gctctagagaatggctcattggagttggaggccgcactcgattattatcgcaggggcgta gagcttctctcgagcctgcgcgagcgtcttgccactgcagagcagcaggtgcaggtgctc tatgatgcttcagcttccaatcaaggctaa

DBGET integrated database retrieval system