Lemur catta (Ring-tailed lemur): 123620186 Help Entry 123620186         CDS       T08326                                  Name (RefSeq) C-C motif chemokine 2-like   KO K14624   C-C motif chemokine 2 Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat04060   Cytokine-cytokine receptor interaction lcat04061   Viral protein interaction with cytokine and cytokine receptor lcat04062   Chemokine signaling pathway lcat04621   NOD-like receptor signaling pathway lcat04657   IL-17 signaling pathway lcat04668   TNF signaling pathway lcat04933   AGE-RAGE signaling pathway in diabetic complications lcat05135   Yersinia infection lcat05142   Chagas disease lcat05144   Malaria lcat05163   Human cytomegalovirus infection lcat05164   Influenza A lcat05168   Herpes simplex virus 1 infection lcat05171   Coronavirus disease - COVID-19 lcat05323   Rheumatoid arthritis lcat05417   Lipid and atherosclerosis lcat05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lcat00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     123620186   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123620186    04061 Viral protein interaction with cytokine and cytokine receptor     123620186  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     123620186    04657 IL-17 signaling pathway     123620186    04062 Chemokine signaling pathway     123620186  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     123620186    05164 Influenza A     123620186    05168 Herpes simplex virus 1 infection     123620186    05163 Human cytomegalovirus infection     123620186   09171 Infectious disease: bacterial    05135 Yersinia infection     123620186   09174 Infectious disease: parasitic    05144 Malaria     123620186    05142 Chagas disease     123620186   09163 Immune disease    05323 Rheumatoid arthritis     123620186   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123620186    05418 Fluid shear stress and atherosclerosis     123620186   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     123620186  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lcat04052]     123620186    00536 Glycosaminoglycan binding proteins [BR:lcat00536]     123620186 Cytokines and neuropeptides [BR:lcat04052]  Cytokines   Chemokines    123620186 Glycosaminoglycan binding proteins [BR:lcat00536]  Heparan sulfate / Heparin   Chemokines    123620186 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 GPR15L CXCL16 Motif Other DBs NCBI-GeneID:  123620186 NCBI-ProteinID:  XP_045381153 LinkDB All DBs Position 15:22873157..22875007 Genome browser AA seq 119 aa AA seqDB search MKVSAMLLCLLLAVAAFSPQGLAQPDAVNAPVTCCYTFSSRKIPLQRLMSYRRVTNSKCP KEAVIFKTVLAKEICTNPKQNWVKDYIAKLDKKTQTPKPLNTHSTTQAPTANLLSPSSP NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctctgcaatgctcctgtgcctgctgctggcagtagccgccttcagcccccag ggccttgctcagccagatgcggttaacgcccccgtcacctgctgctatacattctcaagt aggaagatcccactgcagaggctgatgagctacagaagagtcaccaacagcaagtgtccc aaagaagctgtgatcttcaagaccgtactagccaaggagatctgcacgaaccccaagcag aactgggtcaaggattacattgccaaactggacaagaaaacccaaactccaaagcctttg aacactcactccacaacccaagcacctacagctaacttattgtcccctagctctccctaa

DBGET integrated database retrieval system