Lemur catta (Ring-tailed lemur): 123620933 Help Entry 123620933         CDS       T08326                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat04081   Hormone signaling lcat04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:lcat00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     123620933 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     123620933 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lcat04052]     123620933 (GAST) Cytokines and neuropeptides [BR:lcat04052]  Neuropeptides   GPCR binding    123620933 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  123620933 NCBI-ProteinID:  XP_045382474 LinkDB All DBs Position 15:39078819..39081206 Genome browser AA seq 104 aa AA seqDB search MQRLCVYVLIFVLALAAFSEASWKPRSQLPGAPSGPVANRDLEQHWPDQLSAASHHRRQL GPQGPPHLVADLSKKQGPWMEEEEEAYGWMDFGRRSAEEGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgtgtgtacgtgctgatctttgtgctagccctggccgccttctctgaa gcttcttggaaaccccgttcccagctgccaggtgcgccctcgggtccagtggccaacagg gacctggagcagcactggccggaccagctgagtgcagcttctcaccaccggaggcagctg gggccccagggtcccccacacctcgtggcagacctgtccaagaagcaggggccatggatg gaggaagaagaggaagcttatggatggatggactttggccgccgcagtgctgaggaaggg gaccaacatccctag

DBGET integrated database retrieval system