Lemur catta (Ring-tailed lemur): 123623278 Help Entry 123623278         CDS       T08326                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat04014   Ras signaling pathway lcat04015   Rap1 signaling pathway lcat04022   cGMP-PKG signaling pathway lcat04024   cAMP signaling pathway lcat04062   Chemokine signaling pathway lcat04071   Sphingolipid signaling pathway lcat04072   Phospholipase D signaling pathway lcat04081   Hormone signaling lcat04144   Endocytosis lcat04150   mTOR signaling pathway lcat04270   Vascular smooth muscle contraction lcat04310   Wnt signaling pathway lcat04350   TGF-beta signaling pathway lcat04360   Axon guidance lcat04510   Focal adhesion lcat04520   Adherens junction lcat04530   Tight junction lcat04611   Platelet activation lcat04621   NOD-like receptor signaling pathway lcat04625   C-type lectin receptor signaling pathway lcat04660   T cell receptor signaling pathway lcat04670   Leukocyte transendothelial migration lcat04722   Neurotrophin signaling pathway lcat04810   Regulation of actin cytoskeleton lcat04921   Oxytocin signaling pathway lcat04928   Parathyroid hormone synthesis, secretion and action lcat04972   Pancreatic secretion lcat05100   Bacterial invasion of epithelial cells lcat05132   Salmonella infection lcat05133   Pertussis lcat05135   Yersinia infection lcat05152   Tuberculosis lcat05163   Human cytomegalovirus infection lcat05200   Pathways in cancer lcat05203   Viral carcinogenesis lcat05205   Proteoglycans in cancer lcat05206   MicroRNAs in cancer lcat05210   Colorectal cancer lcat05417   Lipid and atherosclerosis lcat05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lcat00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     123623278 (RHOA)    04015 Rap1 signaling pathway     123623278 (RHOA)    04310 Wnt signaling pathway     123623278 (RHOA)    04350 TGF-beta signaling pathway     123623278 (RHOA)    04072 Phospholipase D signaling pathway     123623278 (RHOA)    04071 Sphingolipid signaling pathway     123623278 (RHOA)    04024 cAMP signaling pathway     123623278 (RHOA)    04022 cGMP-PKG signaling pathway     123623278 (RHOA)    04150 mTOR signaling pathway     123623278 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     123623278 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     123623278 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     123623278 (RHOA)    04660 T cell receptor signaling pathway     123623278 (RHOA)    04670 Leukocyte transendothelial migration     123623278 (RHOA)    04062 Chemokine signaling pathway     123623278 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     123623278 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     123623278 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     123623278 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     123623278 (RHOA)   09158 Development and regeneration    04360 Axon guidance     123623278 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123623278 (RHOA)    05206 MicroRNAs in cancer     123623278 (RHOA)    05205 Proteoglycans in cancer     123623278 (RHOA)    05203 Viral carcinogenesis     123623278 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     123623278 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     123623278 (RHOA)   09171 Infectious disease: bacterial    05135 Yersinia infection     123623278 (RHOA)    05133 Pertussis     123623278 (RHOA)    05152 Tuberculosis     123623278 (RHOA)    05100 Bacterial invasion of epithelial cells     123623278 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123623278 (RHOA)    05418 Fluid shear stress and atherosclerosis     123623278 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lcat04131]     123623278 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lcat04147]     123623278 (RHOA)    04031 GTP-binding proteins [BR:lcat04031]     123623278 (RHOA) Membrane trafficking [BR:lcat04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     123623278 (RHOA) Exosome [BR:lcat04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123623278 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    123623278 (RHOA)   Exosomal proteins of colorectal cancer cells    123623278 (RHOA)   Exosomal proteins of bladder cancer cells    123623278 (RHOA) GTP-binding proteins [BR:lcat04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     123623278 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  123623278 NCBI-ProteinID:  XP_045386195 LinkDB All DBs Position 18:39197701..39249017 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatcaggaagaaactggtgattgttggtgatggagcttgtggcaagacatgc ttgctcatagtcttcagcaaggaccagttcccagaggtgtatgtgcccacggtgtttgag aactatgtggcagatatcgaggtggatggaaagcaggtagaattggctttgtgggacaca gctgggcaggaagattatgaccgcctaaggcccctctcctacccagacactgatgttata ctgatgtgtttctccatcgacagccctgatagtttagaaaacatcccagaaaaatggacc ccagaagtcaagcatttctgtcccaatgtgcccatcatcctggttgggaacaagaaggat cttcggaatgatgagcatacaaggcgggagctagccaaaatgaagcaggagcctgtaaaa cctgaggaaggcagagatatggcgaacagaattggcgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggctacgagagctgctctgcaa gccagacgtggaaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system