Lemur catta (Ring-tailed lemur): 123623456 Help Entry 123623456         CDS       T08326                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat04015   Rap1 signaling pathway lcat04810   Regulation of actin cytoskeleton lcat05014   Amyotrophic lateral sclerosis lcat05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lcat00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     123623456 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     123623456 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     123623456 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     123623456 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lcat04131]     123623456 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:lcat04812]     123623456 (PFN3)    04147 Exosome [BR:lcat04147]     123623456 (PFN3) Membrane trafficking [BR:lcat04131]  Others   Actin-binding proteins    Others     123623456 (PFN3) Cytoskeleton proteins [BR:lcat04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      123623456 (PFN3) Exosome [BR:lcat04147]  Exosomal proteins   Proteins found in most exosomes    123623456 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  123623456 NCBI-ProteinID:  XP_045386533 LinkDB All DBs Position 18:6106610..6107166 Genome browser AA seq 137 aa AA seqDB search MGDWKGYISAVLRDRRIDDVAIVGHADNRCVWASRPGGLLAAISPQEVGVLTGPDRSTFL QAGLSLAGRRCCVIRDYLLAEGDGVLDARTKGLDGRAVCVGHSPRALLVLMGRRGVHGGI LNKTVHELIRGLRTQGA NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggtgactggaaaggctacattagtgcggtgctgcgggatcggcgaatcgacgacgtg gccatcgtgggccacgcggacaatcgctgcgtgtgggcatcgcggcccgggggcctgctg gcggccatctcaccgcaggaggtgggcgtgctcacggggcccgacaggagcaccttcctg caggcgggtctgagcttggcgggccgccgctgctgcgtcatccgcgactacctgctggcc gagggtgacggtgtgctggacgcgcgcacgaaggggctggatgggcgcgcggtctgcgtg ggccactcgccgcgcgcgctcctcgtgctcatgggccgacgcggcgtgcacggcggcatc cttaacaagacggtgcacgagctgatccgcgggctgcgcacgcagggcgcctaa

DBGET integrated database retrieval system