Lemur catta (Ring-tailed lemur): 123624136 Help Entry 123624136         CDS       T08326                                  Name (RefSeq) platelet factor 4-like   KO K05407   platelet factor 4 Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat04060   Cytokine-cytokine receptor interaction lcat04061   Viral protein interaction with cytokine and cytokine receptor lcat04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:lcat00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123624136    04061 Viral protein interaction with cytokine and cytokine receptor     123624136  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     123624136  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lcat04052]     123624136    00536 Glycosaminoglycan binding proteins [BR:lcat00536]     123624136 Cytokines and neuropeptides [BR:lcat04052]  Cytokines   Chemokines    123624136 Glycosaminoglycan binding proteins [BR:lcat00536]  Heparan sulfate / Heparin   Chemokines    123624136 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  123624136 NCBI-ProteinID:  XP_045387705 LinkDB All DBs Position 19:15492759..15493761 Genome browser AA seq 109 aa AA seqDB search MSFPAGSGVSCPRASPGLLLLGLLFLTAAAVATTSASADPEEGVGDLQCLCVRTISRVPP KHVASLEVIKAGPHCPTAQLIATLKHGQKICLDPQASIHKKIIKKLLEI NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgagcttcccagcgggctcaggggtctcttgcccccgggccagcccagggttgctgctc ctggggctgctattcctgacagctgctgcggttgccaccaccagcgccagcgctgaccct gaagaaggcgttggggacctgcaatgcctgtgtgtgaggaccatctcccgggtccctccc aagcatgtcgccagcctggaggtgatcaaggccggaccccactgccccactgcccaactg atagccacgctgaagcatggacagaaaatttgcctggacccgcaggcctctatacataag aaaataattaagaaacttttagagatttag

DBGET integrated database retrieval system