Lemur catta (Ring-tailed lemur): 123631755 Help Entry 123631755         CDS       T08326                                  Symbol CALML4 Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat04014   Ras signaling pathway lcat04015   Rap1 signaling pathway lcat04020   Calcium signaling pathway lcat04022   cGMP-PKG signaling pathway lcat04024   cAMP signaling pathway lcat04070   Phosphatidylinositol signaling system lcat04114   Oocyte meiosis lcat04218   Cellular senescence lcat04261   Adrenergic signaling in cardiomyocytes lcat04270   Vascular smooth muscle contraction lcat04371   Apelin signaling pathway lcat04625   C-type lectin receptor signaling pathway lcat04713   Circadian entrainment lcat04720   Long-term potentiation lcat04722   Neurotrophin signaling pathway lcat04728   Dopaminergic synapse lcat04740   Olfactory transduction lcat04744   Phototransduction lcat04750   Inflammatory mediator regulation of TRP channels lcat04910   Insulin signaling pathway lcat04912   GnRH signaling pathway lcat04915   Estrogen signaling pathway lcat04916   Melanogenesis lcat04921   Oxytocin signaling pathway lcat04922   Glucagon signaling pathway lcat04924   Renin secretion lcat04925   Aldosterone synthesis and secretion lcat04970   Salivary secretion lcat04971   Gastric acid secretion lcat05010   Alzheimer disease lcat05012   Parkinson disease lcat05022   Pathways of neurodegeneration - multiple diseases lcat05031   Amphetamine addiction lcat05034   Alcoholism lcat05133   Pertussis lcat05152   Tuberculosis lcat05163   Human cytomegalovirus infection lcat05167   Kaposi sarcoma-associated herpesvirus infection lcat05170   Human immunodeficiency virus 1 infection lcat05200   Pathways in cancer lcat05214   Glioma lcat05417   Lipid and atherosclerosis lcat05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lcat00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     123631755 (CALML4)    04015 Rap1 signaling pathway     123631755 (CALML4)    04371 Apelin signaling pathway     123631755 (CALML4)    04020 Calcium signaling pathway     123631755 (CALML4)    04070 Phosphatidylinositol signaling system     123631755 (CALML4)    04024 cAMP signaling pathway     123631755 (CALML4)    04022 cGMP-PKG signaling pathway     123631755 (CALML4)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     123631755 (CALML4)    04218 Cellular senescence     123631755 (CALML4)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     123631755 (CALML4)   09152 Endocrine system    04910 Insulin signaling pathway     123631755 (CALML4)    04922 Glucagon signaling pathway     123631755 (CALML4)    04912 GnRH signaling pathway     123631755 (CALML4)    04915 Estrogen signaling pathway     123631755 (CALML4)    04921 Oxytocin signaling pathway     123631755 (CALML4)    04916 Melanogenesis     123631755 (CALML4)    04924 Renin secretion     123631755 (CALML4)    04925 Aldosterone synthesis and secretion     123631755 (CALML4)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     123631755 (CALML4)    04270 Vascular smooth muscle contraction     123631755 (CALML4)   09154 Digestive system    04970 Salivary secretion     123631755 (CALML4)    04971 Gastric acid secretion     123631755 (CALML4)   09156 Nervous system    04728 Dopaminergic synapse     123631755 (CALML4)    04720 Long-term potentiation     123631755 (CALML4)    04722 Neurotrophin signaling pathway     123631755 (CALML4)   09157 Sensory system    04744 Phototransduction     123631755 (CALML4)    04740 Olfactory transduction     123631755 (CALML4)    04750 Inflammatory mediator regulation of TRP channels     123631755 (CALML4)   09159 Environmental adaptation    04713 Circadian entrainment     123631755 (CALML4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123631755 (CALML4)   09162 Cancer: specific types    05214 Glioma     123631755 (CALML4)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     123631755 (CALML4)    05163 Human cytomegalovirus infection     123631755 (CALML4)    05167 Kaposi sarcoma-associated herpesvirus infection     123631755 (CALML4)   09171 Infectious disease: bacterial    05133 Pertussis     123631755 (CALML4)    05152 Tuberculosis     123631755 (CALML4)   09164 Neurodegenerative disease    05010 Alzheimer disease     123631755 (CALML4)    05012 Parkinson disease     123631755 (CALML4)    05022 Pathways of neurodegeneration - multiple diseases     123631755 (CALML4)   09165 Substance dependence    05031 Amphetamine addiction     123631755 (CALML4)    05034 Alcoholism     123631755 (CALML4)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123631755 (CALML4)    05418 Fluid shear stress and atherosclerosis     123631755 (CALML4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lcat01009]     123631755 (CALML4)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lcat04131]     123631755 (CALML4)    03036 Chromosome and associated proteins [BR:lcat03036]     123631755 (CALML4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lcat04147]     123631755 (CALML4) Protein phosphatases and associated proteins [BR:lcat01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      123631755 (CALML4) Membrane trafficking [BR:lcat04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     123631755 (CALML4) Chromosome and associated proteins [BR:lcat03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      123631755 (CALML4) Exosome [BR:lcat04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    123631755 (CALML4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_9 SAPC2_N AIF-1 EH CFAP251_C EF-hand_11 GPHH Motif Other DBs NCBI-GeneID:  123631755 NCBI-ProteinID:  XP_045397684 LinkDB All DBs Position 1:complement(98003932..98014395) Genome browser AA seq 153 aa AA seqDB search MAKFLSQDQINEYKECFSLYDKQQRGKIKATDLMVAMRCLGASPTPGEVQRHLQTHGIDR NGELDFSTFLTIMHMQIKQEDPKKEILLAMLMADKEKKGYIMASELRSKLMRLGEKLTHK EVDDLFRQANIEPNGKVKYDEFIHKITLPVQDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggccaagtttctttcccaggaccaaattaatgagtacaaggaatgcttctccctgtac gacaagcagcagagggggaagataaaagccactgacctcatggtggccatgaggtgcctg ggggccagcccgacgccaggggaggtgcagcggcacctgcagactcatgggatagacaga aatggagagctggatttctccactttcctgaccattatgcacatgcaaataaagcaagag gacccaaagaaagaaattctactggccatgttaatggcggacaaggagaagaaaggttac atcatggcgtctgagctgcggtcaaaactcatgagactgggggagaagctcacccacaag gaagtggatgatcttttcaggcaagcaaacatcgaaccaaatggcaaagtgaagtatgac gaattcatccacaagatcactcttcctgtgcaggactactga

DBGET integrated database retrieval system