Lemur catta (Ring-tailed lemur): 123633235 Help Entry 123633235         CDS       T08326                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat04382   Cornified envelope formation lcat05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lcat00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     123633235  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     123633235  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lcat04147]     123633235 Exosome [BR:lcat04147]  Exosomal proteins   Exosomal proteins of microglial cells    123633235 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_6 TMP_3 DUF2102 Motif Other DBs NCBI-GeneID:  123633235 NCBI-ProteinID:  XP_045400266 LinkDB All DBs Position 2:complement(114767421..114767714) Genome browser AA seq 97 aa AA seqDB search MPSQMQHAMETMMFIFHKFFKDKGYLTKDDLRVLMEKEFPGFLENQKDLRALDKIMKDLD QCRDGKVGFQSFFSLIAGLTLACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatgcaacatgccatggaaaccatgatgtttatatttcacaaatttttc aaggataaaggctacttaacaaaggatgacctgagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccttcgggccttggacaaaataatgaaggacctggac cagtgccgagatggcaaagtgggcttccagagcttcttttccctgattgcaggcctcacc cttgcgtgcaacgactattttgtagtacacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system