Lemur catta (Ring-tailed lemur): 123635081 Help Entry 123635081         CDS       T08326                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat01521   EGFR tyrosine kinase inhibitor resistance lcat01522   Endocrine resistance lcat04010   MAPK signaling pathway lcat04012   ErbB signaling pathway lcat04014   Ras signaling pathway lcat04015   Rap1 signaling pathway lcat04062   Chemokine signaling pathway lcat04068   FoxO signaling pathway lcat04071   Sphingolipid signaling pathway lcat04072   Phospholipase D signaling pathway lcat04137   Mitophagy - animal lcat04140   Autophagy - animal lcat04150   mTOR signaling pathway lcat04151   PI3K-Akt signaling pathway lcat04210   Apoptosis lcat04211   Longevity regulating pathway lcat04213   Longevity regulating pathway - multiple species lcat04218   Cellular senescence lcat04360   Axon guidance lcat04370   VEGF signaling pathway lcat04371   Apelin signaling pathway lcat04540   Gap junction lcat04550   Signaling pathways regulating pluripotency of stem cells lcat04625   C-type lectin receptor signaling pathway lcat04650   Natural killer cell mediated cytotoxicity lcat04660   T cell receptor signaling pathway lcat04662   B cell receptor signaling pathway lcat04664   Fc epsilon RI signaling pathway lcat04714   Thermogenesis lcat04720   Long-term potentiation lcat04722   Neurotrophin signaling pathway lcat04725   Cholinergic synapse lcat04726   Serotonergic synapse lcat04730   Long-term depression lcat04810   Regulation of actin cytoskeleton lcat04910   Insulin signaling pathway lcat04912   GnRH signaling pathway lcat04915   Estrogen signaling pathway lcat04916   Melanogenesis lcat04917   Prolactin signaling pathway lcat04919   Thyroid hormone signaling pathway lcat04921   Oxytocin signaling pathway lcat04926   Relaxin signaling pathway lcat04929   GnRH secretion lcat04933   AGE-RAGE signaling pathway in diabetic complications lcat04935   Growth hormone synthesis, secretion and action lcat05010   Alzheimer disease lcat05022   Pathways of neurodegeneration - multiple diseases lcat05034   Alcoholism lcat05160   Hepatitis C lcat05161   Hepatitis B lcat05163   Human cytomegalovirus infection lcat05165   Human papillomavirus infection lcat05166   Human T-cell leukemia virus 1 infection lcat05167   Kaposi sarcoma-associated herpesvirus infection lcat05170   Human immunodeficiency virus 1 infection lcat05200   Pathways in cancer lcat05203   Viral carcinogenesis lcat05205   Proteoglycans in cancer lcat05206   MicroRNAs in cancer lcat05207   Chemical carcinogenesis - receptor activation lcat05208   Chemical carcinogenesis - reactive oxygen species lcat05210   Colorectal cancer lcat05211   Renal cell carcinoma lcat05213   Endometrial cancer lcat05214   Glioma lcat05215   Prostate cancer lcat05216   Thyroid cancer lcat05218   Melanoma lcat05219   Bladder cancer lcat05220   Chronic myeloid leukemia lcat05221   Acute myeloid leukemia lcat05223   Non-small cell lung cancer lcat05224   Breast cancer lcat05225   Hepatocellular carcinoma lcat05226   Gastric cancer lcat05230   Central carbon metabolism in cancer lcat05231   Choline metabolism in cancer lcat05235   PD-L1 expression and PD-1 checkpoint pathway in cancer lcat05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:lcat00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     123635081 (NRAS)    04012 ErbB signaling pathway     123635081 (NRAS)    04014 Ras signaling pathway     123635081 (NRAS)    04015 Rap1 signaling pathway     123635081 (NRAS)    04370 VEGF signaling pathway     123635081 (NRAS)    04371 Apelin signaling pathway     123635081 (NRAS)    04068 FoxO signaling pathway     123635081 (NRAS)    04072 Phospholipase D signaling pathway     123635081 (NRAS)    04071 Sphingolipid signaling pathway     123635081 (NRAS)    04151 PI3K-Akt signaling pathway     123635081 (NRAS)    04150 mTOR signaling pathway     123635081 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     123635081 (NRAS)    04137 Mitophagy - animal     123635081 (NRAS)   09143 Cell growth and death    04210 Apoptosis     123635081 (NRAS)    04218 Cellular senescence     123635081 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     123635081 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     123635081 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     123635081 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     123635081 (NRAS)    04650 Natural killer cell mediated cytotoxicity     123635081 (NRAS)    04660 T cell receptor signaling pathway     123635081 (NRAS)    04662 B cell receptor signaling pathway     123635081 (NRAS)    04664 Fc epsilon RI signaling pathway     123635081 (NRAS)    04062 Chemokine signaling pathway     123635081 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     123635081 (NRAS)    04929 GnRH secretion     123635081 (NRAS)    04912 GnRH signaling pathway     123635081 (NRAS)    04915 Estrogen signaling pathway     123635081 (NRAS)    04917 Prolactin signaling pathway     123635081 (NRAS)    04921 Oxytocin signaling pathway     123635081 (NRAS)    04926 Relaxin signaling pathway     123635081 (NRAS)    04935 Growth hormone synthesis, secretion and action     123635081 (NRAS)    04919 Thyroid hormone signaling pathway     123635081 (NRAS)    04916 Melanogenesis     123635081 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     123635081 (NRAS)    04726 Serotonergic synapse     123635081 (NRAS)    04720 Long-term potentiation     123635081 (NRAS)    04730 Long-term depression     123635081 (NRAS)    04722 Neurotrophin signaling pathway     123635081 (NRAS)   09158 Development and regeneration    04360 Axon guidance     123635081 (NRAS)   09149 Aging    04211 Longevity regulating pathway     123635081 (NRAS)    04213 Longevity regulating pathway - multiple species     123635081 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     123635081 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123635081 (NRAS)    05206 MicroRNAs in cancer     123635081 (NRAS)    05205 Proteoglycans in cancer     123635081 (NRAS)    05207 Chemical carcinogenesis - receptor activation     123635081 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     123635081 (NRAS)    05203 Viral carcinogenesis     123635081 (NRAS)    05230 Central carbon metabolism in cancer     123635081 (NRAS)    05231 Choline metabolism in cancer     123635081 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     123635081 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     123635081 (NRAS)    05225 Hepatocellular carcinoma     123635081 (NRAS)    05226 Gastric cancer     123635081 (NRAS)    05214 Glioma     123635081 (NRAS)    05216 Thyroid cancer     123635081 (NRAS)    05221 Acute myeloid leukemia     123635081 (NRAS)    05220 Chronic myeloid leukemia     123635081 (NRAS)    05218 Melanoma     123635081 (NRAS)    05211 Renal cell carcinoma     123635081 (NRAS)    05219 Bladder cancer     123635081 (NRAS)    05215 Prostate cancer     123635081 (NRAS)    05213 Endometrial cancer     123635081 (NRAS)    05224 Breast cancer     123635081 (NRAS)    05223 Non-small cell lung cancer     123635081 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     123635081 (NRAS)    05170 Human immunodeficiency virus 1 infection     123635081 (NRAS)    05161 Hepatitis B     123635081 (NRAS)    05160 Hepatitis C     123635081 (NRAS)    05163 Human cytomegalovirus infection     123635081 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     123635081 (NRAS)    05165 Human papillomavirus infection     123635081 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     123635081 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     123635081 (NRAS)   09165 Substance dependence    05034 Alcoholism     123635081 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123635081 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     123635081 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     123635081 (NRAS)    01522 Endocrine resistance     123635081 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lcat04131]     123635081 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lcat04147]     123635081 (NRAS)    04031 GTP-binding proteins [BR:lcat04031]     123635081 (NRAS) Membrane trafficking [BR:lcat04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     123635081 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     123635081 (NRAS) Exosome [BR:lcat04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123635081 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    123635081 (NRAS)   Exosomal proteins of breast cancer cells    123635081 (NRAS)   Exosomal proteins of colorectal cancer cells    123635081 (NRAS) GTP-binding proteins [BR:lcat04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     123635081 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  123635081 NCBI-ProteinID:  XP_045402841 LinkDB All DBs Position 3:complement(18464359..18474633) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaagtcatttgcagatattaacctctacagggagcagatt aaacgagtaaaggattcagatgatgtacctatggtgctggtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccacgagctggccaagagttacgggattcca tttattgaaacctcagccaagaccagacagggtgtcgaagatgccttttacacactggta agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt tgtatggggttgccatgtgtggtgatgtaa

DBGET integrated database retrieval system