Lemur catta (Ring-tailed lemur): 123636664 Help Entry 123636664         CDS       T08326                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat04015   Rap1 signaling pathway lcat04810   Regulation of actin cytoskeleton lcat05014   Amyotrophic lateral sclerosis lcat05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lcat00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     123636664 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     123636664 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     123636664 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     123636664 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lcat04131]     123636664 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:lcat04812]     123636664 (PFN4)    04147 Exosome [BR:lcat04147]     123636664 (PFN4) Membrane trafficking [BR:lcat04131]  Others   Actin-binding proteins    Others     123636664 (PFN4) Cytoskeleton proteins [BR:lcat04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      123636664 (PFN4) Exosome [BR:lcat04147]  Exosomal proteins   Proteins found in most exosomes    123636664 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  123636664 NCBI-ProteinID:  XP_045405108 LinkDB All DBs Position 4:complement(17225544..17232885) Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQEQNLCIASPGFSVMPSDVRRLVNGFAKNPLQAR REGLYFKEKDYKCVRADEYSLYAKNENTGVIVVKTHLYLLVATYTEGMYPSVCVEAAEKL GDYLRKKGS NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagatacactcctgggaaccaagcatgtggacagt gcagccctcatcaaactccaggagcagaacctgtgtatagcatcaccaggatttagtgta atgcccagtgatgtccgaagacttgtgaatggatttgccaagaaccctttgcaagcccga agagaaggactgtatttcaaggaaaaggattacaaatgtgtccgggcagatgaatattct ctttatgctaagaatgaaaacactggcgtgattgttgtgaagacccatctatatcttctg gtggcaacttacactgagggcatgtatcctagtgtctgcgtggaagccgcagagaagctg ggagactatctaagaaaaaaaggaagttaa

DBGET integrated database retrieval system