Lemur catta (Ring-tailed lemur): 123637166 Help Entry 123637166         CDS       T08326                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat01523   Antifolate resistance lcat04010   MAPK signaling pathway lcat04060   Cytokine-cytokine receptor interaction lcat04064   NF-kappa B signaling pathway lcat04217   Necroptosis lcat04380   Osteoclast differentiation lcat04620   Toll-like receptor signaling pathway lcat04621   NOD-like receptor signaling pathway lcat04623   Cytosolic DNA-sensing pathway lcat04625   C-type lectin receptor signaling pathway lcat04640   Hematopoietic cell lineage lcat04657   IL-17 signaling pathway lcat04659   Th17 cell differentiation lcat04668   TNF signaling pathway lcat04750   Inflammatory mediator regulation of TRP channels lcat04932   Non-alcoholic fatty liver disease lcat04933   AGE-RAGE signaling pathway in diabetic complications lcat04936   Alcoholic liver disease lcat04940   Type I diabetes mellitus lcat05010   Alzheimer disease lcat05020   Prion disease lcat05022   Pathways of neurodegeneration - multiple diseases lcat05132   Salmonella infection lcat05133   Pertussis lcat05134   Legionellosis lcat05135   Yersinia infection lcat05140   Leishmaniasis lcat05142   Chagas disease lcat05143   African trypanosomiasis lcat05144   Malaria lcat05146   Amoebiasis lcat05152   Tuberculosis lcat05162   Measles lcat05163   Human cytomegalovirus infection lcat05164   Influenza A lcat05168   Herpes simplex virus 1 infection lcat05171   Coronavirus disease - COVID-19 lcat05321   Inflammatory bowel disease lcat05323   Rheumatoid arthritis lcat05332   Graft-versus-host disease lcat05417   Lipid and atherosclerosis lcat05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lcat00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     123637166 (IL1B)    04064 NF-kappa B signaling pathway     123637166 (IL1B)    04668 TNF signaling pathway     123637166 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123637166 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     123637166 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     123637166 (IL1B)    04620 Toll-like receptor signaling pathway     123637166 (IL1B)    04621 NOD-like receptor signaling pathway     123637166 (IL1B)    04623 Cytosolic DNA-sensing pathway     123637166 (IL1B)    04625 C-type lectin receptor signaling pathway     123637166 (IL1B)    04659 Th17 cell differentiation     123637166 (IL1B)    04657 IL-17 signaling pathway     123637166 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     123637166 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     123637166 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     123637166 (IL1B)    05164 Influenza A     123637166 (IL1B)    05162 Measles     123637166 (IL1B)    05168 Herpes simplex virus 1 infection     123637166 (IL1B)    05163 Human cytomegalovirus infection     123637166 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     123637166 (IL1B)    05135 Yersinia infection     123637166 (IL1B)    05133 Pertussis     123637166 (IL1B)    05134 Legionellosis     123637166 (IL1B)    05152 Tuberculosis     123637166 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     123637166 (IL1B)    05144 Malaria     123637166 (IL1B)    05140 Leishmaniasis     123637166 (IL1B)    05142 Chagas disease     123637166 (IL1B)    05143 African trypanosomiasis     123637166 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     123637166 (IL1B)    05321 Inflammatory bowel disease     123637166 (IL1B)    05332 Graft-versus-host disease     123637166 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     123637166 (IL1B)    05020 Prion disease     123637166 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     123637166 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123637166 (IL1B)    05418 Fluid shear stress and atherosclerosis     123637166 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     123637166 (IL1B)    04936 Alcoholic liver disease     123637166 (IL1B)    04932 Non-alcoholic fatty liver disease     123637166 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     123637166 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     123637166 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lcat04052]     123637166 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:lcat00536]     123637166 (IL1B) Cytokines and neuropeptides [BR:lcat04052]  Cytokines   Interleukins    123637166 (IL1B) Glycosaminoglycan binding proteins [BR:lcat00536]  Heparan sulfate / Heparin   Cytokines    123637166 (IL1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  123637166 NCBI-ProteinID:  XP_045406021 LinkDB All DBs Position 4:68677748..68683650 Genome browser AA seq 268 aa AA seqDB search MAAVPEPASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCLSDGGIQLHISRQHYNKS FRQVVSVIVAVEKLRNKPVLCPKAFQEGDLSTFFPFIFEEEPIIFDSWDDGFVCDAPVRS LNCTLQDTQQKCLVMSGPYQLKALHLQGQDLNQQVVFSMSFVQGEENNDKIPVALGLKDK NLYLSCVMKDGRPTLQLESVDSKSYPKRKMEKRFVFNKIEIKNKLEFESAQFPNWYISTS QAQNMPIFLGNTKGGQDITDFTVHFLSS NT seq 807 nt NT seq  +upstreamnt  +downstreamnt atggcagcagtacctgaacccgccagcgaaatgatggcttactacagtggcaatgaggat gacctgttctttgaagctgatggccccaaacagatgaagtgctccttccaagacctggac ctctgcctttcggatggcggcatccagctacacatctcccgccagcactacaacaagagc ttcaggcaggtcgtgtcggtcatcgtggctgtggagaagctgaggaacaagccagttctc tgccccaaggccttccaggagggcgacctgagcactttctttcccttcatctttgaagaa gagcccatcatcttcgactcgtgggacgacggctttgtgtgtgatgcgcccgtacgatca ctgaactgcacactccaggacacacaacaaaaatgcctggtgatgtctggcccctatcag ctgaaggccctccacctccagggacaggatctgaaccaacaagtggtgttctccatgagt tttgtgcaaggagaagaaaataatgacaaaatacctgtggccttgggcctgaaggacaag aatctgtacctgtcctgtgtgatgaaggatggccggcccaccctgcagctggagagtgtg gactccaaaagttacccaaagaggaagatggaaaagcgatttgtcttcaacaagatagaa atcaaaaacaagctggaatttgagtctgcccagttccccaactggtacatcagcacctct caagcgcaaaacatgcccatcttcctgggaaacaccaaaggcggccaggatataactgac ttcaccgtgcacttcttgtcttcctaa

DBGET integrated database retrieval system