Lemur catta (Ring-tailed lemur): 123638398 Help Entry 123638398         CDS       T08326                                  Name (RefSeq) histone H2B type 1-N   KO K11252   histone H2B Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat04613   Neutrophil extracellular trap formation lcat05034   Alcoholism lcat05203   Viral carcinogenesis lcat05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:lcat00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     123638398  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     123638398   09163 Immune disease    05322 Systemic lupus erythematosus     123638398   09165 Substance dependence    05034 Alcoholism     123638398  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lcat03036]     123638398   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lcat04147]     123638398 Chromosome and associated proteins [BR:lcat03036]  Eukaryotic type   Nucleosome assembly factors    Histones     123638398 Exosome [BR:lcat04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123638398 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  123638398 NCBI-ProteinID:  XP_045407971 LinkDB All DBs Position 5:64279753..64284500 Genome browser AA seq 126 aa AA seqDB search MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggagccctcaaagtccgctcctgccccgaagaagggctccaagaaggcggtgacc aaggcccaaaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgtg tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcttctaaggccatg ggtatcatgaactcttttgtcaacgacatcttcgagcgcatcgcgggcgaggcctctcgc ctggcgcattacaacaagcgctcgaccatcacctcccgggagatccagacggccgtgcgc ctgctgctgccgggagagctggccaagcacgctgtgtccgagggcaccaaggctgtcacc aagtataccagctccaagtga

DBGET integrated database retrieval system